Identifiers and Description

Gene Model Identifier

TTHERM_01220340

Standard Name

GCP4 (Gamma-tubulin Complex Protein 4)

Aliases

PreTt17298 | 279.m00023

Description

Spc97/Spc98 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 16.5%

TetraMine Data

TTHERM_01220340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17175.19.997093137033517e-262Spc97/Spc98 family protein (92
6 aa)
OxytrichaContig19816.0.g92.9991470337942304e-139Spc97 / Spc98 family
Stentor CoeruleusSteCoe_87272.4426007377405277e-36
DictyBaseDDB_G02858490.00000000000020009182674645818spc97 on chromosome: 4 positio
n 3719511 to 3723808

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01220340(coding)
ATGTTACACGAAATACTATTTGGACTGTTAGGGAAATCAGGCAATATTATTATAGAATAA
AATGATAGCTTTGTTTTAGATCCAAAGATAACATTTCTGACTCCTGCTGAAAAGGAGATA
ATTAATAGTCTTTGCTGCTTGGGATATTATTATAAAAATTTAGAATAGTTTTTGGATGAA
AATTACAACAATTTTGCTAAGATAACTTATTTTATGAATAAAAATAATAATTTTAATGAG
AATTGTGATGACCAAAACGATGGTCCAATCGCTGAAGTCAATGTAATTGGAAATAGCGCA
TATTTGAAGGGATTTTGTCTTGGATTAGAATAAATAATCAACAGTTATAGAGAAAAAATC
ATTGAAATAGAGAGGGATTTTTTGGAAAATAGAGTGTTTACAATAGCTTCTTTAAAGATT
AAGTTGACATCTCATTTCGATATTTTGCCAGATTTACATAAAATAGTAATTAAAATTGTA
GAAGAAAATTTAAAGGGAGGCCAACTTTTAGATTTAATGCATAGTAAAAGCTAAACTGGT
AATACAGCCTTAAGGGAAGTATATTAGATTTTGACTGACTAGTGCTATTCTGTTTTATAT
TAGCAACTAAGTGGATGGATTCTCTATGGAAATCTTTAAGATTATTATGATGAGTTTTTT
ATCTACAGGATTGAATAAACGAAATCTTAACAGAGCAATGCTTATGATAAAAATGTGGTA
GAACAACCAAATGAACTAGAAATAGATTGGGATAGCATTTTTTCTTTAAGGTATGCGATG
TTGCCTTAGAGTATTGTTTCACACAAGCAAGCAGAAAAGATATTATTCATAGGAAAAGGT
ATTAGAATATTAAGAAACACATAAAAGGAATATGAAAACTCATTTCTACCTCCACAATAA
ATGCTGACTTTGATTGAAGAAATTCGTCAATATGACAGCTTTAAATTTTAAAACACAATT
GAGTCTTTGAGATACGAAATAGCAAAATAAATGTTGGAACTTGTTCTTAAAAATCAAAAT
TTAATGAATCACTTAAACACTCTAAACAATTATTTTCTTATGGGAAACGGAGAGTTCTTC
AAAGCTTTTTACGAAGAAAGTAGAAGCTTAATGCAGCTACCTCCAAAGCCAGAGAGTGAA
GGTCACTTAAATAATGTGATAGTTCCTCATACTTTAATTAGACTGAGGAATGACGATGAA
ATTGTTAATGCCTTTAAAAATTTTTAGTTCAAGATAAAAAATAATGGATTCGAATTCAAA
GATTTTTCTTAGGTTAATGAATTGAATATATTTGGAAATGTTCACTAACAAAGAAACAAT
TACATCAGATTCTAGCCTCTAAAGAATTCTAAATTGAGTGGATCTTTGTGGTATAAGTTT
AAATAAAATATTGAAATGGGATTTAAACTTAGCTTTACTTTTAGATTTAAAAAAGAGAGA
AATTATTTGCCAATAAATTAGTTTTCAAAATTAGGATCACCAAATATAAATTTATTGCAA
TCTAGCACAAAAGGTAGTGTTAACTTGCTTCAAAGTGAAGAATAATCACCTTTGAAGTCT
AGATTCTCTTATTTCACTAGCAGCATAGCTTAAGATGAAACAAATGAGAATGGTTTATTA
ATTGTTTTCTAAAATACAAAAGAAATCAGCTCTTATAAAAAAGCAGCTCCTTACAGATTA
TAAGACATGAATGAATATGTTGCTATCAAATTTTATACAAAGGAGACCAATAAAAAAGGT
GCTGCTTCAGTTGCAAAAGAAATTAATGACCAAAAATGCTCTATTTAAATGGTTGTTTGC
AATAATGGAAAACCAACTTATATTAAGAATCATGAATTTGATTGTGATAGAGTAAATTTC
TTAGATGGTTAATTGTAAGTCATCAAAATAAACTATGATGGAGAGAATATTGCATTACAT
TTAGAGGATATTGATAACATGAACAGAGGACTTTAAAGTCAGTTATTTACTTTCCCTTTC
AAATTCAATAAATTCCTAAATTTAGACATGGGAAGAGCTTATGTAGGATTTATTTAAGAT
TCAAATAATGGTAATTGTGCCATGGATATTATGAGCTGGTAAATGTATAGTTCAAATGTT
TTTAATAACCAAGATGCATGGAATGGACTTACTATGGACTACCAAGTCAAATGGCCTCTC
AATTTAATGATATCATCTCATTTGATAGAAAAATATAAAACTATATTCAGATATTTATTT
CCTTTAAGAACTATTTAGTTTGAACTGTAAAGATCGTGGCTTTATTTCATGAAAAACAGT
AAAAGAGGCAAGTTAAATCCAACATTAAATTCAATGCTGTTAATGAGAACAAAGCTAAGT
TCAGTAATAGATAGTTTATGGACATACTTTCATACAGACATTATAACTTCATAGTGGTCA
AAACTGTAAGAAAAAGTTGCAGAGATTAAAGACTTTGAAGAACTTAGAAAGATAATTGAT
CTTTTTTTGAGCTCAATATAAATTTAAATTTTCTTAAGCTATCCTAAATTAGTAAAGAGT
ATCTTTGATATTGTCGATTGCTGTAGGAGATATTGTAACATCGTAGTAAAATTAGAATAT
GATACAAGTATTGATTTATTGTAAGCAGACTTTGAGGTTCTAAAAGAAGATTTCGAAAAG
AATTTCATGAATCTTCTTAATTTACTTATACTTATGACAAAAAATACCAATGCAACATTC
TTATTTTAGTTGCTACTTAGATTAGATTTTAATGGCTATTATAGAGAAAAGATGGAAGAT
AAATATAAATACTGA


>TTHERM_01220340(protein)
MLHEILFGLLGKSGNIIIEQNDSFVLDPKITFLTPAEKEIINSLCCLGYYYKNLEQFLDE
NYNNFAKITYFMNKNNNFNENCDDQNDGPIAEVNVIGNSAYLKGFCLGLEQIINSYREKI
IEIERDFLENRVFTIASLKIKLTSHFDILPDLHKIVIKIVEENLKGGQLLDLMHSKSQTG
NTALREVYQILTDQCYSVLYQQLSGWILYGNLQDYYDEFFIYRIEQTKSQQSNAYDKNVV
EQPNELEIDWDSIFSLRYAMLPQSIVSHKQAEKILFIGKGIRILRNTQKEYENSFLPPQQ
MLTLIEEIRQYDSFKFQNTIESLRYEIAKQMLELVLKNQNLMNHLNTLNNYFLMGNGEFF
KAFYEESRSLMQLPPKPESEGHLNNVIVPHTLIRLRNDDEIVNAFKNFQFKIKNNGFEFK
DFSQVNELNIFGNVHQQRNNYIRFQPLKNSKLSGSLWYKFKQNIEMGFKLSFTFRFKKER
NYLPINQFSKLGSPNINLLQSSTKGSVNLLQSEEQSPLKSRFSYFTSSIAQDETNENGLL
IVFQNTKEISSYKKAAPYRLQDMNEYVAIKFYTKETNKKGAASVAKEINDQKCSIQMVVC
NNGKPTYIKNHEFDCDRVNFLDGQLQVIKINYDGENIALHLEDIDNMNRGLQSQLFTFPF
KFNKFLNLDMGRAYVGFIQDSNNGNCAMDIMSWQMYSSNVFNNQDAWNGLTMDYQVKWPL
NLMISSHLIEKYKTIFRYLFPLRTIQFELQRSWLYFMKNSKRGKLNPTLNSMLLMRTKLS
SVIDSLWTYFHTDIITSQWSKLQEKVAEIKDFEELRKIIDLFLSSIQIQIFLSYPKLVKS
IFDIVDCCRRYCNIVVKLEYDTSIDLLQADFEVLKEDFEKNFMNLLNLLILMTKNTNATF
LFQLLLRLDFNGYYREKMEDKYKY


>TTHERM_01220340(gene)
ATGTTACACGAAATACTATTTGGACTGTTAGGGAAATCAGGCAATATTATTATAGAATAA
AATGATAGCTTTGTTTTAGATCCAAAGATAACATTTCTGACTCCTGCTGAAAAGGAGATA
ATTAATAGTCTTTGCTGCTTGGGATATTATTATAAAAATTTAGAATAGTTTTTGGATGAA
AATTACAACAATTTTGCTAAGATAACTTATTTTATGAATAAAAATAATAATTTTAATGAG
AATTGTGATGACCAAAACGATGGTCCAATCGCTGAAGTCAATGTAATTGGAAATAGCGCA
TATTTGAAGGTAATTTAATTCTACTAAAGTATTATCTAAACTATTATTTTCAATAGGGAT
TTTGTCTTGGATTAGAATAAATAATCAACAGTTATAGAGAAAAAATCATTGAAATAGAGA
GGGATTTTTTGGAAAATAGAGTGTTTACAATAGCTTCTTTAAAGATTAAGTTGACATCTC
ATTTCGATATTTTGCCAGATTTACATAAAATAGTATTAAACTTAAACATTTCATAAGCAA
TTATTAAGGATTATTTGTTCAATTTATAAAAAAAGGTAATTAAAATTGTAGAAGAAAATT
TAAAGGGAGGCCAACTTTTAGATTTAATGCATAGTAAAAGCTAAACTGGTAATACAGCCT
TAAGGGAAGTATATTAGATTTTGACTGACTAGTGCTATTCTGTTTTATATTAGCAAGTAA
GAATTATAAATGCAATAACAATACAATTTCATAATATTTTCAAATAAATTTATTTGTGAA
AATTGTTCAAAATTTAATAAATAAATAGCTAAGTGGATGGATTCTCTATGGAAATCTTTA
AGATTATTATGATGAGTTTTTTATCTACAGGATTGAATAAACGAAATCTTAACAGAGTAA
TAAATAAAAAAACAGATTGTATTTGATTTATATTGAAATATATTTTAATTATAATTTGTA
GGCAATGCTTATGATAAAAATGTGGTAGAACAACCAAATGAACTAGAAATAGATTGGGAT
AGCATTTTTTCTTTAAGGTATGCGATGTTGCCTTAGAGTATTGTTTCACACAAGCAAGCA
GAAAAGATATTATTCATAGGAAAAGGTATTAGAATATTAAGAAACACATAAAAGGAATAT
GAAAACTCATTTCTACCTCCACAATAAATGCTGACTTTGATTGAAGAAATTCGTCAATAT
GACAGCTTTAAGTAATCAAATGATATTTGATTTGATTTAGTTTAATTTTTTTAAATGCTA
GATTTTAAAACACAATTGAGTCTTTGAGATACGAAATAGCAAAATAAATGTTGGAACTTG
TTCTTAAAAATCAAAATTTAATGAATCACTTAAACACTCTAAACAATGTAAATTATTATT
GCTTTCATTAATCATCCTTCATTTTATCATTTTAAATTAAATTAAGTATTTTCTTATGGG
AAACGGAGAGTTCTTCAAAGCTTTTTACGAAGAAAGTAGAAGCTTAATGCAGCTACCTCC
AAAGCCAGAGAGTGAAGGTCACTTAAATAATGTGATAGTTCCTCATACTTTAATTAGACT
GAGGAATGACGATGAAATTGTTAATGCCTTTAAAAGTAAATTTTAAAAATCTATCAAACA
TTCTTAACTTGTTTTCAATAATAATTATTAAAATAATCAAATAGATTTTTAGTTCAAGAT
AAAAAATAATGGATTCGAATTCAAAGATTTTTCTTAGGTTAATGAATTGAATATATTTGG
AAATGTTCACTAACAAAGAAACAATTACATCAGATTCTAGCCTCTAAAGAATTCTAAATT
GAGTGGTAAATCAAACAAATCAATTTCTTTTAAATTTTTTATAGCTTTTTAAAAATAAAA
ACATATTGAAACAATAAGAAAAAATTATTTAATTTTGTCTTTTATTATTCAAAATAAATA
AATAATGATTAATTTAAATTTTCTTGCTTTTATTAATTTAAATAGGATCTTTGTGGTATA
AGTTTAAATAAAATATTGAAATGGGATTTAAACTTAGCTTTACTTTTAGATTTAAAAAAG
AGAGAAATTATTTGCCAATAAATTAGTAAATCAATAAAAAAATTTGAAATTTATTCATTA
ATTTATTAACTTTTAATGTAATTAATTGTAGGTTTTCAAAATTAGGATCACCAAATATAA
ATTTATTGCAATCTAGCACAAAAGGTAGTGTTAACTTGCTTCAAAGTGAAGAATAATCAC
CTTTGAAGTCTAGATTCTCTTATTTCACTAGCAGCATAGCTTAAGATGAAACAAATGAGA
ATGGTTTATTAATTGTTTTCTAAAATACAAAAGAAATCAGCTCTTATAAAAAAGCAGCTC
CTTACAGATTATAAGACATGAATGAGTAAATTAATTATTTATAAATTATTAAATATTAAG
ATTTTTTTTAAATTAGATATGTTGCTATCAAATTTTATACAAAGGAGACCAATAAAAAAG
GTGCTGCTTCAGTTGCAAAAGAAATTAATGACCAAAAATGCTCTATTTAAATGGTTGTTT
GCAATAATGGAAAACCAACTTATATTAAGAATCATGAATTTGATTGTGATAGAGTAAATT
TCTTAGATGGTTAATTGTAAGTCATCAAAATAAACTATGATGGAGAGAATATTGCATTAC
ATTTAGAGGATATTGATAACATGAACAGAGGACTTTAAAGTCAGTTATTTACTTTCCCTT
TCAAATTCAATAAATTCCTAAATTTAGACATGGGAAGAGCTTATGTAGGATTTATTTAAG
TAATATAAATATATTGATGTTATTGGAATTTAAATTAATATCAACAATTTCATTAAATTA
AAAGGATTCAAATAATGGTAATTGTGCCATGGATATTATGAGCTGGTAAATGTATAGTTC
AAATGTTTTTAATAACCAAGATGCATGGAATGGACTTACTATGGACTACCAAGTCAAATG
GCCTCTCAATTTAATGATATCATCTCATTTGATAGAAAAATATAAAACTATATTCAGATA
TTTATTTCCTTTAAGGTAAATAATTAACAATTTTCTTATTAAAATTAATTTAATTAATAT
TTCAAAATATTTTAGTCAAATCATACACTCATTCATACATTCATTATAAGCAAACATATC
AACCTTAAAAAAATTTTTTTTTGATTTATTTTAAAGCACGAATTTTTTTGCGATAAAATA
TTTATAATTTAGAAATATTTAATAATTAAATGTAAAATAATTTTACATTATGAGATATTT
TGGGATATATAAATTGAATTATAATTATTACACTAAATTCTTTTAATGGAAAATTTATTT
TAAGAACTATTTAGTTTGAACTGTAAAGATCGTGGCTTTATTTCATGAAAAACAGTAAAA
GAGGCAAGTTAAATCCAACATTAAATTCAATGCTGTTAATGAGAACAAAGCTAAGTTCAG
TAATAGATAGTTTATGGACATACTTTCATACAGACATTATAACTTCATAGTGGTCAAAAG
TAAAAATAGATTAATTAATCATTTAAAATATATAAAATTTTTTATATTATTTTCAAATAG
CTGTAAGAAAAAGTTGCAGAGATTAAAGACTTTGAAGAACTTAGAAAGATAATTGATCTT
TTTTTGAGCTCAATATAAATTTAAATTTTCTTAAGCTATCCTAAATTAGTAAAGAGTATC
TTTGATATTGTCGATTGCTGTAGGAGATATTGTAACATCGTAGTAAAGTAAAAATTTTGA
TTAAAAAATATATTCTTTTATTTTTTATCTCATTTAAATTAATTAATACAGATTAGAATA
TGATACAAGTATTGATTTATTGTAAGCAGACTTTGAGGTTCTAAAAGAAGATTTCGAAAA
GAATTTCATGAATCTTCTTAATTTACTTATACTTATGACAAAAAATACCAATGCAACATT
CTTATTTTAGTTGCTACTTAGATTAGATTTTAATGGCTATTATAGAGAAAAGATGGAAGA
TAAATATAAATACTGA