Identifiers and Description

Gene Model Identifier

TTHERM_00112620

Standard Name

GCP3 (Gamma-tubulin Complex Protein 3)

Aliases

PreTt27076 | 8.m00336 | 3812.m02374

Description

Spc97/Spc98 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.8%

TetraMine Data

TTHERM_00112620

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD01782 ) Micronucleus: GCP3 gene partially replaced by neo4-KanR2 cassette.

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03951.19.997093137033517e-262Spc97/Spc98 family protein (12
26 aa)
OxytrichaContig15036.0.g262.000319284850678e-127Spc97 / Spc98 family
DictyBaseDDB_G02839095.998439611888618e-47spc98 on chromosome: 4 positio
n 1376667 to 1379177
Stentor CoeruleusSteCoe_182732.031092662734811e-42
SGDYNL126W2.9998215087698487e-30SPC98 Component of the microtu
bule-nucleating Tub4p (gamma-t
ubulin) complex; interacts wit
h Spc110p at the spindle pole
body (SPB) inner plaque and wi
th Spc72p at the SPB outer pla
que

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00112620(coding)
ATGGGAGACCAGCAAAAGGCTTTAACAAAGTGGGTACAGATTCTTATAGAATCTGAAATG
CATGGAGTTAATGAAGTTACTATCCAGAAGGCATTAAGCTATTTTATGAAGATGTTATCT
GGACGCTTTGGCGCCAGAGTGACTGATGAAAAAGTTATAAAAAATTAATTGATAAGACAA
GCGAAAACAAATCAGTAACAATTAAGAGTGTAGGAGCTGTTAAATAAATTAGATAAGTAC
CCTGCTGCTATTTAAAATAAATCAGCGATTCTTCATTTATTATTTGCACTCTCGAATAGC
GCTGAAATTAAACAGCATTTTGATAATGTGGAAGCTCTGTTTAAAAATAATAATTAGGGA
ATTAACACCACCATGGAAATAGAAAATAATACAACAATGAATACTTTAGCTAATAACTAG
TCTAATACTTTTAACTAAACTTAGAAGTCTTTTTTAGGCTAAAGTAACATTTAGTTCTTA
CAAACAATAAAAAAGATTAGCAACAAAGGTAATCCTAACATAGATCTAACTGAAAAAGAT
TTGATTAGGGATCTTTTGTTTACTTTTCAAGCTATTGATGGCCACTATATCACTCTTAAT
AAATAAGAAGACAAGTTTATGCTTAAAAATAATGTTTCTGTATCTGATCCAGTTAGAGAA
ATGGTTAATAAATTAGCTAGTATGGGAGATTTATTTAGAAAGATATAAATATACTTATAA
GGAGAACCTTAAGGATAGATTCGTTAAGCACTTCACTAAGCTATTAGAGATGAATTAAAT
GAGTATTATAGATTGATAGCAATTTTTGAAAATGAATTAAATGCTTCATATAACAATTAA
ATCCTTTCCTAAAATAATTAATCCTTGCTACTAAGCTAAGCTTCCTATCAAAATCCATAA
TAAAATAATGAAAATAACTAAAATAGTGTAAATCTTTAAAATGGATTTAATCCTAATTAA
TTTACTTTAAGAAAATTGTAGTTATGGGTAATTGAACCTATGGAAAGATTGAAATGGTTA
GCTATCATATGTGATGCAACTAAAGGAATGAGCGGATTTTAAGTAATATCTGCTGTCAAT
GCTTACGAAACATAAGGAAGTCCTCCTATCTAGTAGCTAATTAGCAGAATCCTCCAAAGT
ATCGTTTAGCCTTTCATTAAATATGTTAACTCATGGGTTTACAATGGAGAATTAAGTGAT
CCATTAGGAGAATTTTTTGTAACAGAAAATGTAGGTGAAGCTGATATTTGGAATAAAAGA
TATTCTATGGTAATAAAATAAATTCCTAACATCATAGACAAACATAATGCAATTACAATT
TTTAACATTGGTAGAAGTGTCAACTTTCTACACAAATCATGTAAATCCAGTGACTGGAAG
TTAAACTTAGCTCCTTGCAATTTGAAGATTGTTGATAAAAAAAGTTTTGATGTTTTTAAA
TAGTGGATTTATGAGGCTGCATTGTTAACCAACAACAGAATAGTTAATATTTTGGTTGAC
AGATACTAGCTAAAGTAGCATTTATTGAACATAAAAAGGTATATTTTAATGGGATAAGGT
GATTTTATTTAGTCACTTATGGAAGTACTCTCTGAGTAACTCTCTAAAAATGCAAACGAA
ATACATCGTCATAATCTTTTATCTATTCTCGATGGTGTGATAAAAGGAAATAGTAATGCC
TTTTAAGAAAGCAGCTAAAGATTAGATATTAAATTGTTAGAGGCCTCTCCTGGAGATAAA
GGTTGGGATATCTTTACTTTGGATTATAATGTAGACTCTCCTATAGATACTATATTGTCT
CCATCCGTGATGAGAAATTACCTAAAGATATTCAATTTCTTATGGAGAGTACGTAGAGTT
AGTCACTGCTTGTCTTAAATTTGGTTGGATCATATGAAGTCTGCAAATCTAATTGGAAGA
GAAAGATCTCATGAACCTATTTCCAAACTCATGAAAAAGTTTAATATACTCCGTCATTAA
ATGACCCATTTCATAAATAATTTAACTTGCTATATCATGGTAGATGCGATTGAAACAACT
TGGAAGCAATTCCTTGATGATTTTGATAAAACCAAGGACTTTGCAGAAATCATTTAGACT
CACATAAATTTTGTATAGTCCGTCTTAGATAAGTCTCTCTTAACAGATAAGAATATTAAT
ATTTATAGACTAATGAATTCTCTATTTAATTTGATTATCAAATTTAGAAATACTTAAATG
ATTATATTAACTGAAATTCAAGAAGAATATGAGCGTATCAGAGCTATCAAAAATACAAAT
AAGCAAAAAGCTATTCTCAGTGAGTTTGGTCACGATTTTTCACGTAATAAAGATTTTGAT
TAGGAAGATGATGAACATGGTAGCGGTAGCGATCATTAGCTTGAGTCTGAAGACTTTTAA
ATTCCTTAGAATGCAAATTAATTTAACTAAATTTAAAAAGATTTTCAAAAGTAATTTACA
GAATTGTTAATATTACTTAAAAAAGAAGACAAGCTCCGTTTCTTGAGTTTTAAGTTAGAT
TTCAATGAATATTATAATTCAAGATAGAATGAATCTCTAGCTAATTTTGGATAAGACTAA
CTAAATAAATACTCAGCCAGTGGTACATTAAGGATGTAAAATTTTAACGTAAAAGTTAAT
AGCAATTAAGGAAGCAGCTAAAATCTTGGTGGTGAAATCCCTACTTACAACAATAACACA
AAGCTTTTTAATTTAGGTCCCCACAGCAACAGCTTACCTCCTAACAGGGAAACTTCTTAA
TTCTTTAAACCTGATGTTAACACGGCTATTCCTAAGCCTAATAACTTTGGAGCTGATTTA
AACACCAAAGACAGCTTCTTCTCTGCCTTATCAAATAATAACAATTTAAAGAATAGCGGA
TTTATCAAAAAAGACTCATCGTTCCTCCAAAATAACTCCTTGTTCAATTAGGATCAATCT
TCTATTGCTAACAACAGCAAAAATAATCTAAATAAAACAAATCTAACTGGATTTAGCAAT
CTTGATATTAACAGCTAAAAATCTTTGAATAACTTCTTTTAAGGTAAAAGTAATGCCAGT
ATAAATCTTACCCAAAAATAAGATTTCTTCAAACCTTCTTCTGGTATGCCTTCAAATAGA
AGCTATAAGACTGTTGAAAGCAACTTTACAAAGATGGAAGAAGAGTAAAATGCAGATAGA
CAAAATGCTTATTAAGCAAACTTATTCTCTAAAAATAATCCATTCAGCAACAACTTTACA
GGAATGGATTCAGAAGCATTTAAGTAAAGAATAAATAATCAACAGCAAATCTCTAATGAA
GATTATCTAAGATAAAATAAATTGCCACAACCTTAATAGAACAATTTCTTTTAAGCTTAA
AATAAAACACAACAACAAAGAATTAACAGCAGAAACAATTTATCAAGACAATAAGAAGGG
GATGAAGAAGAAGACTAAAAATATTAAGATTCAGACTAGAAAAATTATAACTCGTCTGAT
ATGTACAATAAAGATGATCAGGATGAATAATACGAGTAAGGAGAACATGAAGAATACGAA
GATTAATATGATGATCAATATATCAACGATCAGTATTAGCAAAATGATGAAGAAGATGAT
CAGGAAGATCACAATTAATCTAACTACGAATGA


>TTHERM_00112620(protein)
MGDQQKALTKWVQILIESEMHGVNEVTIQKALSYFMKMLSGRFGARVTDEKVIKNQLIRQ
AKTNQQQLRVQELLNKLDKYPAAIQNKSAILHLLFALSNSAEIKQHFDNVEALFKNNNQG
INTTMEIENNTTMNTLANNQSNTFNQTQKSFLGQSNIQFLQTIKKISNKGNPNIDLTEKD
LIRDLLFTFQAIDGHYITLNKQEDKFMLKNNVSVSDPVREMVNKLASMGDLFRKIQIYLQ
GEPQGQIRQALHQAIRDELNEYYRLIAIFENELNASYNNQILSQNNQSLLLSQASYQNPQ
QNNENNQNSVNLQNGFNPNQFTLRKLQLWVIEPMERLKWLAIICDATKGMSGFQVISAVN
AYETQGSPPIQQLISRILQSIVQPFIKYVNSWVYNGELSDPLGEFFVTENVGEADIWNKR
YSMVIKQIPNIIDKHNAITIFNIGRSVNFLHKSCKSSDWKLNLAPCNLKIVDKKSFDVFK
QWIYEAALLTNNRIVNILVDRYQLKQHLLNIKRYILMGQGDFIQSLMEVLSEQLSKNANE
IHRHNLLSILDGVIKGNSNAFQESSQRLDIKLLEASPGDKGWDIFTLDYNVDSPIDTILS
PSVMRNYLKIFNFLWRVRRVSHCLSQIWLDHMKSANLIGRERSHEPISKLMKKFNILRHQ
MTHFINNLTCYIMVDAIETTWKQFLDDFDKTKDFAEIIQTHINFVQSVLDKSLLTDKNIN
IYRLMNSLFNLIIKFRNTQMIILTEIQEEYERIRAIKNTNKQKAILSEFGHDFSRNKDFD
QEDDEHGSGSDHQLESEDFQIPQNANQFNQIQKDFQKQFTELLILLKKEDKLRFLSFKLD
FNEYYNSRQNESLANFGQDQLNKYSASGTLRMQNFNVKVNSNQGSSQNLGGEIPTYNNNT
KLFNLGPHSNSLPPNRETSQFFKPDVNTAIPKPNNFGADLNTKDSFFSALSNNNNLKNSG
FIKKDSSFLQNNSLFNQDQSSIANNSKNNLNKTNLTGFSNLDINSQKSLNNFFQGKSNAS
INLTQKQDFFKPSSGMPSNRSYKTVESNFTKMEEEQNADRQNAYQANLFSKNNPFSNNFT
GMDSEAFKQRINNQQQISNEDYLRQNKLPQPQQNNFFQAQNKTQQQRINSRNNLSRQQEG
DEEEDQKYQDSDQKNYNSSDMYNKDDQDEQYEQGEHEEYEDQYDDQYINDQYQQNDEEDD
QEDHNQSNYE


>TTHERM_00112620(gene)
ATGGGAGACCAGCAAAAGGCTTTAACAAAGTGGGTACAGATTCTTATAGAATCTGAAATG
CATGGAGTTAATGAAGTTACTATCCAGAAGGCATTAAGCTATTTTATGAAGATGTTATCT
GGACGCTTTGGCGCCAGAGTGACTGATGAAAAAGTTATAAAAAATTAATTGATAAGACAA
GCGAAAACAAATCAGTAACAATTAAGAGTGTAGGAGCTGTTAAATAAATTAGATAAGTAC
CCTGCTGCTATTTAAAATAAATCAGCGATTCTTCATTTATTATTTGCACTCTCGAATAGC
GCTGAAATTAAACAGCATTTTGATAATGTGGAAGCTCTGTTTAAAAATAATAATTAGGGA
ATTAACACCACCATGGAAATAGAAAATAATACAACAATGAATACTTTAGCTAATAACTAG
TCTAATACTTTTAACTAAACTTAGAAGTCTTTTTTAGGCTAAAGTAACATTTAGTTCTTA
CAAACAATAAAAAAGATTAGCAACAAAGGTAATCCTAACATAGATCTAACTGAAAAAGAT
TTGATTAGGGATCTTTTGTTTACTTTTCAAGCTATTGATGGCCACTATATCACTCTTAAT
AAATAAGAAGACAAGTTTATGCTTAAAAATAATGTTTCTGTATCTGATCCAGTTAGAGAA
ATGGTTAATAAATTAGCTAGTATGGGAGATTTATTTAGAAAGATATAAATATACTTATAA
GGAGAACCTTAAGGATAGATTCGTTAAGCACTTCACTAAGCTATTAGAGATGAATTAAAT
GAGTATTATAGATTGATAGCAATTTTTGAAAATGAATTAAATGCTTCATATAACAATTAA
ATCCTTTCCTAAAATAATTAATCCTTGCTACTAAGCTAAGCTTCCTATCAAAATCCATAA
TAAAATAATGAAAATAACTAAAATAGTGTAAATCTTTAAAATGGATTTAATCCTAATTAA
TTTACTTTAAGAAAATTGTAGTTATGGGTAATTGAACCTATGGAAAGATTGAAATGGTTA
GCTATCATATGTGATGCAACTAAAGGAATGAGCGGATTTTAAGTAATATCTGCTGTCAAT
GCTTACGAAACATAAGGAAGTCCTCCTATCTAGTAGCTAATTAGCAGAATCCTCCAAAGT
ATCGTTTAGCCTTTCATTAAATATGTTAACTCATGGGTTTACAATGGAGAATTAAGTGAT
CCATTAGGAGAATTTTTTGTAACAGAAAATGTAGGTGAAGCTGATATTTGGAATAAAAGA
TATTCTATGGTAATAAAATAAATTCCTAACATCATAGACAAACATAATGCAATTACAATT
TTTAACATTGGTAGAAGTGTCAACTTTCTACACAAATCATGTAAATCCAGTGACTGGAAG
TTAAACTTAGCTCCTTGCAATTTGAAGATTGTTGATAAAAAAAGTTTTGATGTTTTTAAA
TAGTGGATTTATGAGGCTGCATTGTTAACCAACAACAGAATAGTTAATATTTTGGTTGAC
AGATACTAGCTAAAGTAGCATTTATTGAACATAAAAAGGTATATTTTAATGGGATAAGGT
GATTTTATTTAGTCACTTATGGAAGTACTCTCTGAGTAACTCTCTAAAAATGCAAACGAA
ATACATCGTCATAATCTTTTATGTAATCTTACTTAATTTTTTGAAAAATATTAATCAGCA
ATATTTGAATACTAACTATCACAAAAGCTTTATTTTAATTTAAAAAAAAAAATTCCATTT
TTAAAATTCACAAAAATAATGTGAACTGTTTTTAAATAATTAAATAATATTTAGAAATTA
CTTTTCAAGTTTTTAAATTAAAAGAAAAGTCAAATTTTATTTGAGAGAAGATTTTGTTAA
AAAATTACAAAATAAAAAAAATAATTTTATAAAAAGCTATTCTCGATGGTGTGATAAAAG
GAAATAGTAATGCCTTTTAAGAAAGCAGCTAAAGATTAGATATTAAATTGTTAGAGGCCT
CTCCTGGAGATAAAGGTTGGGATATCTTTACTTTGGATTATAATGTAGACTCTCCTATAG
ATACTATATTGTCTCCATCCGTGATGAGAAATTACCTAAAGATATTCAATTTCTTATGGA
GAGTACGTAGAGTTAGTCACTGCTTGTCTTAAATTTGGTTGGATCATATGAAGTCTGCAA
ATCTAATTGGAAGAGAAAGATCTCATGAACCTATTTCCAAACTCATGAAAAAGTTTAATA
TACTCCGTCATTAAATGACCCATTTCATAAATAATTTAACTTGCTATATCATGGTAGATG
CGATTGAAACAACTTGGAAGCAATTCCTTGATGATTTTGATAAAACCAAGGACTTTGCAG
AAATCATTTAGACTCACATAAATTTTGTATAGTCCGTCTTAGATAAGTCTCTCTTAACAG
ATAAGAATATTAATATTTATAGACTAATGAATTCTCTATTTAATTTGATTATCAAATTTA
GAAATACTTAAATGATTATATTAACTGAAATTCAAGAAGAATATGAGCGTATCAGAGCTA
TCAAAAATACAAATAAGCAAAAAGCTATTCTCAGTGAGTTTGGTCACGATTTTTCACGTA
ATAAAGATTTTGATTAGGAAGATGATGAACATGGTAGCGGTAGCGATCATTAGCTTGAGT
CTGAAGACTTTTAAATTCCTTAGAATGCAAATTAATTTAACTAAATTTAAAAAGATTTTC
AAAAGTAATTTACAGAATTGTTAATATTACTTAAAAAAGAAGACAAGCTCCGTTTCTTGA
GTTTTAAGTTAGATTTCAATGAATATTATAATTCAAGATAGAATGAATCTCTAGCTAATT
TTGGATAAGACTAACTAAATAAATACTCAGCCAGTGGTACATTAAGGATGTAAAATTTTA
ACGTAAAAGTTAATAGCAATTAAGGAAGCAGCTAAAATCTTGGTGGTGAAATCCCTACTT
ACAACAATAACACAAAGCTTTTTAATTTAGGTCCCCACAGCAACAGCTTACCTCCTAACA
GGGAAACTTCTTAATTCTTTAAACCTGATGTTAACACGGCTATTCCTAAGCCTAATAACT
TTGGAGCTGATTTAAACACCAAAGACAGCTTCTTCTCTGCCTTATCAAATAATAACAATT
TAAAGAATAGCGGATTTATCAAAAAAGACTCATCGTTCCTCCAAAATAACTCCTTGTTCA
ATTAGGATCAATCTTCTATTGCTAACAACAGCAAAAATAATCTAAATAAAACAAATCTAA
CTGGATTTAGCAATCTTGATATTAACAGCTAAAAATCTTTGAATAACTTCTTTTAAGGTA
AAAGTAATGCCAGTATAAATCTTACCCAAAAATAAGATTTCTTCAAACCTTCTTCTGGTA
TGCCTTCAAATAGAAGCTATAAGACTGTTGAAAGCAACTTTACAAAGATGGAAGAAGAGT
AAAATGCAGATAGACAAAATGCTTATTAAGCAAACTTATTCTCTAAAAATAATCCATTCA
GCAACAACTTTACAGGAATGGATTCAGAAGCATTTAAGTAAAGAATAAATAATCAACAGC
AAATCTCTAATGAAGATTATCTAAGATAAAATAAATTGCCACAACCTTAATAGAACAATT
TCTTTTAAGCTTAAAATAAAACACAACAACAAAGAGTAAATTTTTTTAATTTATATTTCA
ATAAATTTATTTTAAATTTAAAATTAGATTAACAGCAGAAACAATTTATCAAGACAATAA
GAAGGGGATGAAGAAGAAGACTAAAAATATTAAGATTCAGACTAGAAAAATTATAACTCG
TCTGATATGTACAATAAAGATGATCAGGATGAATAATACGAGTAAGGAGAACATGAAGAA
TACGAAGATTAATATGATGATCAATATATCAACGATCAGTATTAGCAAAATGATGAAGAA
GATGATCAGGAAGATCACAATTAATCTAACTACGAATGA