Identifiers and Description

Gene Model Identifier

TTHERM_00426160

Standard Name

GCP2 (Gamma-tubulin Complex Protein 2)

Aliases

PreTt14051 | 47.m00246

Description

Spc97/Spc98 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF04130 ) Spc97 / Spc98 family
  • ( PF07852 ) Protein of unknown function (DUF1642)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00426160

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_123560
Tetrahymena borealisEI9_00181.19.997093137033517e-262Spc97/Spc98 family protein (93
7 aa)
OxytrichaContig22101.0.g339.997093137033517e-262Spc97 / Spc98 family
DictyBaseDDB_G02858493.0009061039838537e-46spc97 on chromosome: 4 positio
n 3719511 to 3723808
SGDYHR172W0.000000000004997916451710233SPC97 Component of the microtu
bule-nucleating Tub4p (gamma-t
ubulin) complex; interacts wit
h Spc110p at the spindle pole
body (SPB) inner plaque and wi
th Spc72p at the SPB outer pla
que

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00426160(coding)
ATGATTTAAGAAAACGGAACAGGATTGTCTTATTTGACAAAGATTGGTATTAAAAACACT
AGAAACAATAGATATTTGAGCCATCAATATACTTATGATACAGAAAAAAATGAATTAACA
GGCAATTCGGTTTAAATGAGCGCAATTCATCCTTTTTTAAAATAATAAACACAAGTTTAA
GAAACTGATTCCATTGAAGAATTCATAATTTATAATTCCTAAAATTAGGATTATCCAGGG
TTTATTTTGTTTGGTTCCTAAGTGCATATAAAGAATAGTTAAGGGTATTATTTACTATGC
CAAGCAGATGGTTCATTAAAAATGGAAAAGCCAGAGTATGAAGAGAATTTTTAAAACGGG
ATAACTTTTAAGTCAGCAAAATGGACTTTAGTTGATGCAAATAATCAACAATCAAAAAGA
TAAATTCATGTTTATGAGGAAATTGCTTTTAAATCGCCATATGGAAATTACTTAATATGT
GAAAATTTAAATACTGTAAGTGCCAATAGTCCAAATATTTCTCCTGACTCTATGTGGAGA
ATTTGTAAGAGTCATATACCTTTCATGCCAACATGGACAGAGCCTACTGATTTTAGCTCA
TTTTTGACAGCAACAAATACACAGATAGCATATTAAGAAAAATAATAATTACTTAACAAA
ACATAAGAGAAAAAAAATCTAGGAGCAATGAGTCCCTAATTACAAGAGCTTTATTTAATC
GAAGATTTACTATTTGTCATGACAGGAATAGAAGGAAATTATATCAAGAAAAAGGCAGAT
TAGTACAGAAAACCCTATATTTATTGCATCGAACCATACTTAGAAACTTCAACATGTGAA
AGTTCTTTGAAATAATTAGTTAATAAAATTCTTGAAATTTGCTTACAGTATGATAAAATA
TAAAATTACATTGCATAGCATTAATAATTTTCTTTTGGAACTGTTTCGCAGGCTCTTTGT
GCTGCATTAGGACTTCTCCTTAGAGAGTATGTTGTAATGATTAACTAACTCGATTAAGAG
TTCCAGAAAGCAGAGCTTACTTTGCAAAAATTATGGTTTTACATACAGCCATCTCTTAAA
GTTATGGAAGCATTATACAAGCTAGTATCTGAAACAGAAAATTATAAGGGAGGAGAATTA
TTGAGTAAATTGTATGATTTGCTTAAAAATACTAGTGACAAATAGATAGTTGATATATAT
TATTATGTTTTGTAGAAATCTTTTGCTCCATATGTTTAAATGCTTTCATAGTGGATTTAT
TATGGTTAAATTGATGACTTATTCTAAGAGTTTTTTATATAGGAAAATGTTTTTGTTAAG
AGGGATAACATTTCAAAAGATTTTAAAGAAAATTACTGGGATTAGAGATTCATTTTGAGG
GAGAAATAAGTACCAGCATTCCTTTATTTGTGGAAGGAAATGGTTTTTAAGACAGGTAAA
TATCTCAGTGTGTTGAGTGAGCATGAAGGAAAAGTTGTTTCTAGTCCTTTTGAATTAGAT
TTGGTTTAAAATTACGAAACTTACTTGTAAATGTAAGATTTTTCATAACCAATTTAAAAG
GCTTACGAATGGGCAAATGCTTAAATAATGCATTTGGTTGTTGTCGATTAAGATTTATAA
GGCAGATTAAAGTCAATAAAAAATTATTTCTTTTTGGAAAGAGGCGATTTTTTCGTTTAC
TTCTTAGACAGTTCAGAAGAAGAACTCATCAAGCAGGCAAGATAAGTCTCAAAAGAAAAG
TTAGAGAGTTTATTAGAAATGTCAATTAGAACAAGCAGTCTGTCTTCAGATCCTTATGTT
GAAGATCTCACTTACGAGTTTAGTCAATACACCCTAAAAGAACAGCTATTTGCCTATCAA
AATTCTTAAATGAACCCAAATCTTTTAAATGATTAAAATCAAGAGAAGTTCAAAATTCAT
ACTCCAGCTCTTACTTTGAAAGGATTAGATCTGTTTTCACTTGATTACAGGATCAAGTGG
CCTCTTAATTTAATTTTTAACAGAAAAACTCTTACAAAATACTAACTGATTTTCCGTCAT
TTATTTAACTGCAAATATATTGAAAGATAGCTGAGTAATGCATGGCTTGTTCAATAATCC
ATGAAAGAATTAAATGTATAAAGAATATTTTTGAAAGGTTATGCTCTAACTCAAAGAATG
ATCCATTATGTAAAAAATTTCATATATTATATTTGCTTTGAGGTAATTGAAACTAAGTGG
CAAAAGCTTAAAAGTAACTTGAAATCAGTTTAATAATTCGAAGACATCATACAACACCAC
GATTAATTCTTAGATGAATGCTTAAAGGAATGCGTTTTGCTCGATACTTCCCTTATAAAC
ACAATATAATCAATAAATTCTTGCTGTCAGACTTTTGCTCAATTTATATAAAATAACATT
TCAATCATTAAAAAGCCAGAAAGCCAAAATACAGCTCATCTTTTAAATTAAGATGAAAAG
AAAACACCTTTGCAGTAAAGAAAGGAATAAGTTGAAGAATAAAGAAAGCATGCTAGAATT
CTTGTTGCAGAAAAAAATTACAAAGATTTCTTTTAAAAATACACTTAAAAATTTGACTCG
AGTTTGAAAGACCTTATGAAAATAATTAACAATATGATTACAAAATATGACACCTACTTA
ATAAATTTAATTGCCAGATTAGATTTTGATGGATTCTACAGTAATTAGTGGAGTTTCAAT
TAAGGAGCTATGGAAGGATAAAATTAATTTTTTGAAAATAATAACAATGATAAAAATTAA
TCGTATTAAATGTTTTAGAAAAAGATCTGA


>TTHERM_00426160(protein)
MIQENGTGLSYLTKIGIKNTRNNRYLSHQYTYDTEKNELTGNSVQMSAIHPFLKQQTQVQ
ETDSIEEFIIYNSQNQDYPGFILFGSQVHIKNSQGYYLLCQADGSLKMEKPEYEENFQNG
ITFKSAKWTLVDANNQQSKRQIHVYEEIAFKSPYGNYLICENLNTVSANSPNISPDSMWR
ICKSHIPFMPTWTEPTDFSSFLTATNTQIAYQEKQQLLNKTQEKKNLGAMSPQLQELYLI
EDLLFVMTGIEGNYIKKKADQYRKPYIYCIEPYLETSTCESSLKQLVNKILEICLQYDKI
QNYIAQHQQFSFGTVSQALCAALGLLLREYVVMINQLDQEFQKAELTLQKLWFYIQPSLK
VMEALYKLVSETENYKGGELLSKLYDLLKNTSDKQIVDIYYYVLQKSFAPYVQMLSQWIY
YGQIDDLFQEFFIQENVFVKRDNISKDFKENYWDQRFILREKQVPAFLYLWKEMVFKTGK
YLSVLSEHEGKVVSSPFELDLVQNYETYLQMQDFSQPIQKAYEWANAQIMHLVVVDQDLQ
GRLKSIKNYFFLERGDFFVYFLDSSEEELIKQARQVSKEKLESLLEMSIRTSSLSSDPYV
EDLTYEFSQYTLKEQLFAYQNSQMNPNLLNDQNQEKFKIHTPALTLKGLDLFSLDYRIKW
PLNLIFNRKTLTKYQLIFRHLFNCKYIERQLSNAWLVQQSMKELNVQRIFLKGYALTQRM
IHYVKNFIYYICFEVIETKWQKLKSNLKSVQQFEDIIQHHDQFLDECLKECVLLDTSLIN
TIQSINSCCQTFAQFIQNNISIIKKPESQNTAHLLNQDEKKTPLQQRKEQVEEQRKHARI
LVAEKNYKDFFQKYTQKFDSSLKDLMKIINNMITKYDTYLINLIARLDFDGFYSNQWSFN
QGAMEGQNQFFENNNNDKNQSYQMFQKKI


>TTHERM_00426160(gene)
ATGATTTAAGAAAACGGAACAGGATTGTCTTATTTGACAAAGGTAGTTATATTATAGAAT
AGTCTTAAGCACAGTTCATACATACTAAATATAAAATGTTTATAAATAATAAATAGATTG
GTATTAAAAACACTAGAAACAATAGATATTTGAGCCATCAATATACTTATGATACAGAAA
AAAATGAATTAACAGGCAATTCGGTTTAAATGAGCGCAATTCATCCTTTTTTAAAATAAT
AAACACAAGTTTAAGAAACTGATTCCATTGAAGAATTCATAATTTATAATTCCTAAAATT
AGGTATTTATCTTGATTGCCGTTTCTTTATTTTTAAAACAGCATTTATTCTATCTCAAAT
CTTACTCATCTCAATTAAATATGATAGGATTATCCAGGGTTTATTTTGTTTGGTTCCTAA
GTGCATATAAAGAATAGGTAATATATCATTTATTACAATACAGTTAATAACATTAAATGC
GTGATAGACCTAAATATTTGACAAATGTTCTTTTTAACATAAATTAGTTAAGGGTATTAT
TTACTATGCCAAGCAGATGGTTCATTAAAAATGGAAAAGCCAGAGTATGAAGAGAATTTT
TAAAACGGGATAACTTTTAAGTCAGCAAAATGGACTTTAGTTGATGCAAATAATCAACAA
TCAAAAAGATAAATTCATGTTTATGAGGAAATTGCTTTTAAATCGCCATATGGAAATTAC
TTAATATGTGAAAATTTAAATACTGTAAGTGCCAATAGTCCAAATATTTCTCCTGACTCT
ATGTGGAGAATTTGTAAGAGTCATATACCTTTCATGCCAACATGGACAGAGCCTACTGAT
TTTAGCTCATTTTTGACAGCAACAAATACACAGATAGCATATTAAGAAAAATAATAATTA
CTTAACAAAACATGTAACATTATCAAATATAATAACTAAATTTATCATATAAATTGTTTT
ATTACTATTATTTTAGAAGAGAAAAAAAATCTAGGAGCAATGAGTCCCTAATTACAAGAG
CTTTATTTAATCGAAGATTTACTATTTGTCATGACAGGAATAGAAGGTAATTAAAGATAA
ATAAATATATGTATCATTAGTAAGTATATGATATTATCATAATTAGACATTATTGTATTA
AAATGGACATTCTTATATTAAAAATGGATATTCTTATATTAAGCCAAATTAGTTAGATAT
AAATTAAAATAATTAAGCTTAAAAATATTTTTTATGTAAAAATGGAAGGTAGATTGTGAA
TTTAATTTTAATTTAATAGGAAATTATATCAAGAAAAAGGCAGATTAGTACAGAAAACCC
TATATTTATTGCATCGAACCATACTTAGAAACTTCAACATGTGAAAGTTCTTTGAAATAA
TTAGTTAATAAAATTCTTGAAATTTGCTTACAGTATGATAAAATATAAAATTACATTGCA
TAGCATTAATAATTTTCTTTTGGAACTGTTTCGCAGGCTCTTTGTGCTGCATTAGGACTT
CTCCTTAGAGAGTATGTTGTAATGATTAACTAACTCGATTAAGAGTTCCAGAAAGCAGAG
CTTACTTTGCAAAAATTATGGTTTTACATACAGCCATCTCTTAAAGTTATGGAAGCATTA
TACAAGCTAGTATCTGAAACAGAAAATTATAAGGTAATTTCAAAATTATTTGAACTAAAA
AAATATAGAAAAATATTAATAAAAATAGCTAGAGTTAATTATTTAAAAGAATCAATAAAT
AAATAAATATTTCTTTTGAATAATAATCAATTAGTAAAAAGCTCTAATTGTTTTCAAGAT
TATTTAAGCCAAATAAATTTTAATCGTTCAAATAATAAAATAATTTGTTACTTTTCAAAT
TTAAATGTAAATTGCAATTCAATCTTAAGCAAGCATAATATGATTCATGCAATATTTAAA
AGAAGCATGAGTAACTTACTCATTTTTTACTTTTATCATTTAGAATATCAAATAATCTTC
AAAAAAACATTTTCTGATAATTATTTAAAATAAATTCAGTTTAGTTGAATAAAATAAATA
ATTAAAAATAAAGTTTAAAGAATAAATTTTGTTTTAAAAATTCCTAATTGAATTTTTAAT
AGTAATTGGTATACTCTAAAGATAACTTTATCAAATTTAATTATAAAGCTAAAGAAAAAA
CAGAAAATATAAAACATTTACTCAAATATTTACATTTATTTATTAATTTTTATGGAAAAT
TTTTTATTCAATTAAAAAACTAATAAGGGAGGAGAATTATTGAGTAAATTGTATGATTTG
CTTAAAAATACTAGTGACAAATAGATAGTTGATATATATTATTATGTTTTGTAGAAATCT
TTTGCTCCATATGTTTAAATGCTTTCATAGTGGATTTATTATGGTTAAATTGATGACTTA
TTCTAAGAGTTTTTTATATAGGAAAATGTTTTTGTTAAGAGGGATAACATTTCAAAAGAT
TTTAAAGAAAATTACTGGGATTAGAGATTCATTTTGAGGGAGAAATAAGTACCAGCATTC
CTTTATTTGTGGAAGGAAATGGTTTTTAAGACAGGTAAATATCTCAGTGTGTTGAGTGAG
CATGAAGGAAAAGTTGTTTCTAGTCCTTTTGAATTAGATTTGGTTTAAAATTACGAAACT
TACTTGTAAATGTAAGATTTTTCATAACCAATTTAAAAGGCTTACGAATGGGCAAATGCT
TAAATAATGCAGTAAAAACAATTTTTATATGCTATTCATATTTTAAATTTAATTAAATTC
TAAAATTTAGTTTGGTTGTTGTCGATTAAGATTTATAAGGCAGATTAAAGTCAATAAAAA
ATTATTTCTTTTTGGAAAGAGGCGATTTTTTCGTTTACTTCTTAGACAGTTCAGAAGAAG
AACTCATCAAGCAGGCAAGATAAGTCTCAAAAGAAAAGTTAGAGAGTTTATTAGAAATGT
CAATTAGAACAAGCAGTCTGTCTTCAGATCCTTATGTTGAAGATCTCACTTACGAGTTTA
GTCAATACACCCTAAAAGAACAGCTATTTGCCTATCAAAATTCTTAAATGAACCCAAATC
TTTTAAATGATTAAAATCAAGAGAAGTTCAAAATTCATACTCCAGCTCTTACTTTGAAAG
GATTAGATCTGTTTTCACTTGATTACAGGATCAAGTGGCCTCTTAATTTAATTTTTAACA
GAAAAACTCTTACAAAATACTAACTGATTTTCCGTCATTTATTTAACTGCAAATATATTG
AAAGATAGCTGAGTAATGCATGGCTTGTTCAATAATCCATGAAAGAATTAAATGTATAAA
GAATATTTTTGAAAGGTTATGCTCTAACTCAAAGAATGATCCATTATGTAAAAAATTTCA
TATATTATATTTGCTTTGAGGTAATTGAAACTAAGTGGCAAAAGCTTAAAAGTAACTTGA
AATCAGTTTAATAATTCGAAGACATCATACAACACCACGATTAATTCTTAGATGAATGCT
TAAAGGAATGCGTTTTGCTCGATACTTCCCTTATAAACACAATATAATCAATAAATTCTT
GCTGTCAGACTTTTGCTCAATTTATATAAAATAACATTTCAATCATTAAAAAGCCAGAAG
TAATTTTTTTTTATAAACAAATTTTATTTATTTTTTACCTAAAACTAAAAGAAAAGTCTT
AAAAAAATTAATTTTTGAAAAATTCTAAACTTAAAAAATAAATTGTATTAATGTAATTTC
TAAAATATAAAAAAAGAGCCAAAATACAGCTCATCTTTTAAATTAAGATGAAAAGAAAAC
ACCTTTGCAGTAAAGAAAGGAATAAGTTGAAGTAATTAATTAATTGATAAAAAGTTTTAG
CTATATTTAAAAAATAAAATTAGGAATAAAGAAAGCATGCTAGAATTCTTGTTGCAGAAA
AAAATTACAAAGATTTCTTTTAAAAATACACTTAAAAATTTGACTCGAGTTTGAAAGACC
TTATGAAAATAATTAACAATATGTAAATTTAAACGTTTAAAAGTATTATTTTTAAAAATA
ATAAATTTATATTAGGATTACAAAATATGACACCTACTTAATAAATTTAATTGCCAGATT
AGATTTTGATGGATTCTACAGTAATTAGTGGAGTTTCAATTAAGGAGCTATGGAAGGATA
AAATTAATTTTTTGAAAATAATAACAATGATAAAAATTAATCGTATTAAATGTTTTAGAA
AAAGATCTGA