Identifiers and Description

Gene Model Identifier

TTHERM_00043770

Standard Name

GAL5 (GALactosidase 5)

Aliases

PreTt11054 | 3.m01761 | 3824.m02817

Description

Alpha-galactosidase, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

  • hydrolase activity, hydrolyzing O-glycosyl compounds (IEA) | GO:0004553

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 91.3%

TetraMine Data

TTHERM_00043770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01876.19.997093137033517e-262alpha-galactosidase (387 aa)
DictyBaseDDB_G02714902.9995941501461703e-129melA on chromosome: 2 position
432789 to 434039
OxytrichaContig19465.0.g678.000283641444557e-129Melibiase
WormBaseWBGene000110958.999119107228014e-72locus:gana-1 status:Confirme
d UniProt:Q21801 protein_i
d:CAB00120.1
Stentor CoeruleusSteCoe_15414.7111658015535965e-58

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000307

Sequences

>TTHERM_00043770(coding)
ATGAGAAAATTAATTGCTATTTTGCTAATTGCTTGTGCTATTAGCTCCGTTAGCTGCTTA
GATAACGGTCTTGCTAAAACTCCTGCTATGGGCTGGAACTCTTGGAACCATTTTGCATGT
AACATTAACGAAGATTTAATTAAAGCAACTGCTGATTAAATTGTCAACTCTGGCCTCGCT
GCTCTTGGTTATAATTACATTAACCTTGATGACTGTTGGTAAATTTCTAGAGATGCTGAT
GGTTACATTGTTGAAGATAAGGAAAAGTTCCCCTCTGGTATAAAGGCCTTGGCTGACTAT
GTTCATAGTAAAGGTTTAAAGTTTGGTCTTTACAGTGATGCTGGTGAATTTACTTGCTAA
AAGAGACCAGGTTCTTTAGGTTATGAAGTCAAGGATGCTTAAAGATATGCTGAATGGGAA
GTTGACTACCTTAAATATGACAACTGCTTCAATAAAAATATTAACCCAAAAATTAGATAT
CCTCCCATGAGAGATGCTCTTAATGCCACTGGTCGTCCCATCTATTTCTCTATGTGTGAA
TGGGGTTAATACAATCCTGCCACCTGGGCTCCTGAAGTTGGTAACTCTTGGAGAACTACT
GGAGATATTAAAGATCGCTATTCTTCATTCTTATCTATCCTTGAAAAATAGGTTGGATTA
GAAAAATATGCTCATCCTGGTGCTTGGAATGATCCTGATATGTTAGAAGTTGGTAACGGT
GGTATGACTACTCATGAATACGAAGCTCATTTTGCTCTTTGGGCCCTTTTGAAGGCTCCT
CTTTTGATTGGTTGTGATGTTAGCAAAATGTCAGAAGACACTATTAGAATTCTTACAAAC
AAAGAAATAATTGCTATTAATCAAGATCCTTTGGGTATCTAAGGCCACAGAGTTAAAAAA
TCTGGATTTTGGTTCTGGAGCTGGTAACTTTGGATGGGTTAACTTGAAGATGGTGTTGCT
ATCATTCTTTTCAATACCTCTGCTTGGGAAAGAAACTTGTCTTTCACATTCAAAGAAGTT
GGAATAGTAGGACCTGCTACCATCAGAGATCTATACTAACACGAAGACTTGGGTGTCTTT
AGCAATTCTTTCTCTGCTATAGTTCCTAAGCACGGAGTTGTTGTAGTTAAAGTAGTACCT
GTCTGA


>TTHERM_00043770(protein)
MRKLIAILLIACAISSVSCLDNGLAKTPAMGWNSWNHFACNINEDLIKATADQIVNSGLA
ALGYNYINLDDCWQISRDADGYIVEDKEKFPSGIKALADYVHSKGLKFGLYSDAGEFTCQ
KRPGSLGYEVKDAQRYAEWEVDYLKYDNCFNKNINPKIRYPPMRDALNATGRPIYFSMCE
WGQYNPATWAPEVGNSWRTTGDIKDRYSSFLSILEKQVGLEKYAHPGAWNDPDMLEVGNG
GMTTHEYEAHFALWALLKAPLLIGCDVSKMSEDTIRILTNKEIIAINQDPLGIQGHRVKK
SGFWFWSWQLWMGQLEDGVAIILFNTSAWERNLSFTFKEVGIVGPATIRDLYQHEDLGVF
SNSFSAIVPKHGVVVVKVVPV


>TTHERM_00043770(gene)
ATGAGAAAATTAATTGCTATTTTGCTAATTGCTTGTGCTATTAGCTCCGTTAGCTGCTTA
GATAACGGTCTTGCTAAAACTCCTGCTATGGGCTGGAACTCTTGGAACCATTTTGCATGT
AACATTAACGAAGATTTAATTAAAGCAACTGCTGATTAAATTGTCAACTCTGGCCTCGCT
GCTCTTGGTTATAATTACATTAACCTTGATGACTGTTGGTAAATTTCTAGAGATGCTGAT
GGTTACATTGTTGAAGATAAGGAAAAGGTAAATCTTATACCATTCATCTATTATGAATAA
GATTCATTACATTAATATTTACCCTTATACAACTCAATAAACATATTTTTTAATAAATTA
ACAATAGTTCCCCTCTGGTATAAAGGCCTTGGCTGACTATGTTCATAGTAAAGGTTTAAA
GTTTGGTCTTTACAGTGATGCTGGTGAATTTACTTGCTAAAAGAGACCAGGTTCTTTAGG
TTATGAAGTCAAGGATGCTTAAAGATATGCTGAATGGGAAGTTGACTACCTTAAATATGA
CAACTGCTTCAATAAAAATATTAACCCAAAAATTAGATATCCTCCCATGAGAGATGCTCT
TAATGCCACTGGTCGTCCCATCTATTTCTCTATGTGTGAATGGGGTTAATACAATCCTGC
CACCTGGGCTCCTGAAGTTGGTAACTCTTGGAGAACTACTGGAGATATTAAAGATCGCTA
TTCTTCATTCTTATCTATCCTTGAAAAATAGGTAAGATATCTTTTGTCTAACTTTTTATT
TTGAAAGCATTACACTTTATTTAATGAAAATATGCAAATATGCATTCACGCTATATAAAT
TCGCTTAAAATTTGCTAATCATAAGAATCGTAAATTATAAAATATAAGATGCCTTTTTCA
TCCATAAAATCATAATAAATTCGTGATAAATCATAAAATTATAATAAAAAGCCATAGATA
GCTTTGGTTTTAGATTATTGACATAGGTGATTACTTATGTTTAATCATAAATTTACAATT
GTAACAATTATAGATTTTTCACCTCATATTTATATTAATTATTTATTACTAAAAAAAATA
AATGCTAAAGTTTACTGTTTTATATTTAAAAAGGTTGGATTAGAAAAATATGCTCATCCT
GGTGCTTGGAATGATCCTGATATGTTAGAAGTTGGTAACGGTGGTATGACTACTCATGAA
TACGAAGCTCATTTTGCTCTTTGGGCCCTTTTGAAGGCTCCTCTTTTGATTGGTTGTGAT
GTTAGCAAAATGTCAGAAGACACTATTAGAATTCTTACAAACAAAGAAATAATTGCTATT
AATCAAGATCCTTTGGGTATCTAAGGCCACAGAGTTAAAAAATCTGGATTTTGGTTCTGG
AGCTGGTAACTTTGGATGGGTTAACTTGAAGATGGTGTTGCTATCATTCTTTTCAATACC
TCTGCTTGGGAAAGAAACTTGTCTTTCACATTCAAAGAAGTTGGAATAGTAGGACCTGCT
ACCATCAGAGATCTATACTAACACGAAGACTTGGGTGTCTTTAGCAATTCTTTCTCTGCT
ATAGTTCCTAAGCACGGAGTTGTTGTAGTTAAAGTAGTACCTGTCTGA