Identifiers and Description

Gene Model Identifier

TTHERM_00841280

Standard Name

Forc1 (Friend of RebL1 in conjugation)

Aliases

PreTt16213 | 147.m00065 | 3741.m00011

Description

Tonsoku-like protein. Interacts with RebL1 during conjugation.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00841280

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18953.19.002093297142233e-23hypothetical protein (184 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):

Sequences

>TTHERM_00841280(coding)
ATGGATTAAAAAGTAGGCTAGAAAAATAACAGTTTGAACTAAACTTATAGATATACATAA
AAAAAATTAAATATCTTTGAATTGCAGTACCATAATAGGATATAAAGAATTGAAGTAGAA
AGACGTGCGTGTACTATACAGAAGCTAATCTAGACCAACGAATAAGATTAAAAACCATAA
ACTTTAAATGAAATGATAGTACAGCCAAAGCTCTATTATTAACAAAATGATCCTACTATG
ATTTTTGAAACACAAATTCAATTTCCAAATGGGTTTACTCAAGTTTTGATTAATGAAGTC
AAAATAATATTTTCTAGTAGCAAAGGATAAAGGAATTAATTATCTAAAAATAAATATCAA
AGCTAAAATTTTGATTTAAACTCAAAGAGTGCAAACGAAAAAGAATAAATATTTTTAATT
TTGGAAGACTTTTATATTGACGTGAGAGTAGATTCAAAAAAATGTAAAAATAAAAGTTAC
TTTCGTTATATTTAGGATGATCCAGTGATTGAATCCAAAGTGATGTTTGTATCTAATGCA
TTAAGAGAATGCTTAATTATAAAGAATATAATTAAATCTCATAAAAAAATGATAACTTCA
ATTCTAAATATTATTTTTTATGAAGACAAGTGTTTTGATAAAAATCTATTCAAAATTATT
TCTAAACCAAAAAAAATGAGTAATAATAAACAGCAGTTCTCAAATTTTGATCCTGAATAT
TAAAACTCTAATTTAACAGGCAGTAGCTCAGATTCTAATAGCATAAAAACTAGCGAGAAT
GAAGTCAGGTAAAAATCAAAAGAAGATGAAAGAAATTTTATGGGATAATCTGAAAATATA
GGATTTTAGATTAATGGGTAAAAAATTGATGATGTGACACAGAGTATTTAAGAATCATAA
AATAATACTAATTTTGTCTAGTTTAATGAATAGGAGACTAGTCAAAGCAATTTATTTAAT
ATATTAAATGACATCATAAAATAAAAATATACAATTTAACAGAATAAAAATGATGACCAA
TAAAATTTTTAGAAAAATGAAAACATTTTAGCCGAGGAATAGTTGAATATCAGCTAATAA
AATTGTAAAAATACTTCACAGCAATTAGGAACTTTATCAAAGAAAAATGTTGTAAAAAAT
ATTGTGAAAGCCTTTCAAAGATATCTAAAAAGTGAAGAGTTCAAATAAGAAATTGAAACA
ATTTTGGAAAAGCATAGTTCAATTTCATATGAGCCATTTTTAAAAAAGTATTTAAGCTAT
GAAAAGAAAAAAAGTTACAATAACAATCTAATTAAGCTATTAATCAATAATGAAGATTTT
TCGAGTGTTTTCAAATTTTTCATAAAAAATAGGTCAAAATAAATGCTTTAAAACTCAAAT
GTTTCAGATAAAATTACCCATTTTTAAATTCTTGATAAATATATTGATGCTATTGAAGAT
CCCCACTCTAATGGTAATATATTTAGCTCCAAAAAAGTAGGCACAAAAAAGAAGAAGAGT
AAACAAAATTGA


>TTHERM_00841280(protein)
MDQKVGQKNNSLNQTYRYTQKKLNIFELQYHNRIQRIEVERRACTIQKLIQTNEQDQKPQ
TLNEMIVQPKLYYQQNDPTMIFETQIQFPNGFTQVLINEVKIIFSSSKGQRNQLSKNKYQ
SQNFDLNSKSANEKEQIFLILEDFYIDVRVDSKKCKNKSYFRYIQDDPVIESKVMFVSNA
LRECLIIKNIIKSHKKMITSILNIIFYEDKCFDKNLFKIISKPKKMSNNKQQFSNFDPEY
QNSNLTGSSSDSNSIKTSENEVRQKSKEDERNFMGQSENIGFQINGQKIDDVTQSIQESQ
NNTNFVQFNEQETSQSNLFNILNDIIKQKYTIQQNKNDDQQNFQKNENILAEEQLNISQQ
NCKNTSQQLGTLSKKNVVKNIVKAFQRYLKSEEFKQEIETILEKHSSISYEPFLKKYLSY
EKKKSYNNNLIKLLINNEDFSSVFKFFIKNRSKQMLQNSNVSDKITHFQILDKYIDAIED
PHSNGNIFSSKKVGTKKKKSKQN


>TTHERM_00841280(gene)
ATGGATTAAAAAGTAGGCTAGAAAAATAACAGTTTGAACTAAACTTATAGATATACATAA
AAAAAATTAAATATCTTTGAATTGCAGTACCATAATAGGATATAAAGAATTGAAGTAGAA
AGACGTGCGTGTACTATACAGAAGCTAATCTAGACCAACGAATAAGATTAAAAACCATAA
ACTTTAAATGAAATGATAGTACAGCCAAAGCTCTATTATTAACAAAATGATCCTACTATG
ATTTTTGAAACACAAATTCAATTTCCAAATGGGTTTACTCAAGTTTTGATTAATGAAGTC
AAAATAATATTTTCTAGTAGCAAAGGATAAAGGAATTAATTATCTAAAAATAAATATCAA
AGCTAAAATTTTGATTTAAACTCAAAGAGTGCAAACGAAAAAGAATAAATATTTTTAATT
TTGGAAGACTTTTATATTGACGTGAGAGTAGATTCAAAAAAATGTAAAAATAAAAGTTAC
TTTCGTTATATTTAGGATGATCCAGTGATTGAATCCAAAGTGATGTTTGTATCTAATGCA
TTAAGAGAATGCTTAATTATAAAGAATATAATTAAATCTCATAAAAAAATGATAACTTCA
ATTCTAAATATTATTTTTTATGAAGACAAGTGTTTTGATAAAAATCTATTCAAAATTATT
TCTAAACCAAAAAAAATGAGTAATAATAAACAGCAGTTCTCAAATTTTGATCCTGAATAT
TAAAACTCTAATTTAACAGGCAGTAGCTCAGATTCTAATAGCATAAAAACTAGCGAGAAG
TAATTTAAAAATTAAATTGTCTATTCTAAATCTATTTGCCTTTTTTACTCAAATTAAAAG
TGAAGTCAGGTAAAAATCAAAAGAAGATGAAAGAAATTTTATGGGATAATCTGAAAATAT
AGGTAAAAATGACTCTAAATGAAATTTTTTTCAATTTAAAAAATATTTTTTATAAATTCA
ATTTAATTTATAATTTATTAAAATAGGATTTTAGATTAATGGGTAAAAAATTGATGATGT
GACACAGAGTATTTAAGAATCATAAAATAATACTAATTTTGTCTAGTTTAATGAATAGGA
GACTAGTCAAAGCAATTTATTTAATATATTAAATGACATCATAAAATAAAAATATACAAT
TTAACAGAATAAAAATGATGACCAATAAAATTTTTAGAAAAATGAAAACATTTTAGCCGA
GGAATAGTTGAATATCAGCTAATAAAATTGTAAAAATACTTCACAGCAATTAGGAACTTT
ATCAAAGAAAAATGTTGTAAAAAATATTGTGAAAGCCTTTCAAAGATATCTAAAAAGTGA
AGAGTTCAAATAAGAAATTGAAACAATTTTGGAAAAGCATAGTTCAATTTCATATGAGCC
ATTTTTAAAAAAGTATTTAAGCTATGAAAAGAAAAAAAGTTACAATAACAATCTAATTAA
GCTATTAATCAATAATGAAGATTTTTCGAGTGTTTTCAAATTTTTCATAAAAAATAGGTC
AAAATAAATGCTTTAAAACTCAAATGTTTCAGATAAAATTACCCATTTTTAAATTCTTGA
TAAATATATTGATGCTATTGAAGATCCCCACTCTAATGGTAATATATTTAGCTCCAAAAA
AGTAGGCACAAAAAAGAAGAAGAGTAAACAAAATTGA