Identifiers and Description

Gene Model Identifier

TTHERM_01005120

Standard Name

FZY6 (FiZzY 6)

Aliases

PreTt27629 | 192.m00067 | 3757.m00315

Description

Fizzy/CDC20/CDH1 family protein; homolog of S. cerevisiae CDH1, a cell cycle regulated activator of the anaphase-promoting complex /cyclosome (APC/C), which directs ubiquitination of various targets

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_01005120

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19885.19.997093137033517e-262hypothetical protein (657 aa)
OxytrichaContig4092.0.g707.99823656470583e-173WD domain, G-beta repeat
WormBaseWBGene000015102.0007019863683806e-141locus:fzr-1 status:Partially
_confirmed UniProt:Q09649
protein_id:CAA87433.1
DictyBaseDDB_G02872599.002272056803922e-129cdh1 on chromosome: 5 position
54882 to 57146
SGDYGL003C9.998496826795377e-105CDH1 Cell-cycle regulated acti
vator of the anaphase-promotin
g complex/cyclosome (APC/C), w
hich directs ubiquitination of
cyclins resulting in mitotic
exit; targets the APC/C to spe
cific substrates including Cdc
20p, Ase1p, Cin8p and Fin1p
Stentor CoeruleusSteCoe_281383.257488532207521e-70

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000046

Sequences

>TTHERM_01005120(coding)
ATGGATTATCTAGAATTTGGAGGATAAGAATGGTCGCAACCAATGTAAGCGGATATGCTA
TGTAGCAACAATACCAAGCAAAGCTAGTTACTATAAGGAAATCTTTAGGTAATGAAGAAT
GGGTGCGAAATAAATGATAATTAGTCATGGACCACTGACACTTCAATTCCTTCTTAGGAT
ATTGACTATCCGTCAATATCTTACCAAAATAATAAGCTTTCACCCATACATAGCCCACAA
TATTCATAAAATAGCACTCATTTATTTAAGGCGAATTCATTAGAAAACAGCGTTGAAAAT
AGTTACTTCAAAGATAGTATCTCTTCTCCATCTTTCTAGCCTAGCTATTTATCTATGTCT
TAAAGTTATCACTAATCAGCAGGATAGTAGAAATAAATACCTTCTTCTAGTTTTAGAAAG
CAATAACCTTAGAGTTAAGATCAATCTATCTAATTAGCAAACCCTTTTAGCAGAAAATTA
TAGTCTTCATCTTTGGCTCATTAAATAGAAGGTATAGAAAGTAAATAGGCAAAAAAGACT
GACTATATCACTGATAGATATATTCCAAGCAGAAAATAATCTAAATTAAATACTTACTAA
GCTTACGAGTGTAATGAAAACTATAATTATTATGAAAACCAATTTACCACTGATAGTCCC
CGTGGATCTAGCACAAACAGTGTATTTGTAAAAAATGCAGTTGACAAGGAGGAAATAAAC
TAAATCAGTATTTCTCAATTATATAAAAACTATGTTTTGGGTATCAAAGATAAAAGAATG
CTGAATCTTTCTTTAAGTTCTGCTCATGCGTTTTGTCCCTATAAAAACTAGAACGTATTG
CGTTTCACCAAACCAAATATATTAAAGAATAGTATGCAAATAGGTATTGAAGCTAATCAG
CAAAAAAGTATATTGCAGTCATCAAGTGCTTACCCAAATTAGCTATTCCTGAACTTAGAA
GAAGAATAGTGTTGCTCCCATTTGCGCTTTTCCCGTAAAATATCAAAAGTACCATTTAAA
GTTCTAGATGCTCCAGCTCTATAAGATGATTTCTACCTAAATTTAATTGATTGGTCAAGT
TAAAATATTCTTGCAGTCGGTTTATCATCATGCGTTTACTTATGGAGTGCATGTTCTTCA
AGAGTAACCAAGCTTTGTGATTTTGGAAGAACAAACGAAGTAACGTCAGTTAATTGGTCA
CCAAGAAGCTCCCTCATTTCAATTGGTACTAACACTGGAGAAGTAGAAATATGGGATTCT
GTAAAACTAGAAAAAGTGAGAGTTATGAAAGGACATTCATAAAGAGTTGGAACTCTTGCA
TGGAATACAAACATTTTAACTAGTGGTTCTAGAGATAAAACTATATTGCAAAGAGATTTA
CGTACTAAAAATTTATATGAATAGAAGTTGATAGGCCATAAATAAGAAGTATGTGGATTA
AAATGGTCTTTTGATGAATAGTAACTTGCTTCAGGAGGAAACGATAATAAGTTATTTGTA
TGGAATATGCATTCAAACAAACCTATTACTAAATTTGGTAATCATAATGCAGCAGTAAAA
GCTCTTGCCTGGTCACCTCATTAACATGGATTGTTAGTTTCTGGAGGAGGAACACAAGAT
AGAACCATCAGATTTTGGAATACTCTTACAAGTAGACAACTAGAATGTATTGAAACAGGA
AGTTAAGTTTGTAACTTGATCTTTAGTAAAAATGTAAATGAGCTAGTTAGCACTCATGGA
TATAGCTAAAACTAAATAATTATATGGAGTTATCCAGAAATGGAAAAGCTAATTACTTTA
ACAGGTCATTCATGCAGAGTTCTTTATTTAGCTATGAGCCCAGATGGATAAACTATTGTC
ACAGGTGCTGGTGATGAAACCTTAAGGTTTTGGAATGTCTTTCCCAGTAACAAGGAAAAA
TAAATAGATGATTCTACTTCGACTTTACTATCTAAAAATCATGCACTAAGATGA


>TTHERM_01005120(protein)
MDYLEFGGQEWSQPMQADMLCSNNTKQSQLLQGNLQVMKNGCEINDNQSWTTDTSIPSQD
IDYPSISYQNNKLSPIHSPQYSQNSTHLFKANSLENSVENSYFKDSISSPSFQPSYLSMS
QSYHQSAGQQKQIPSSSFRKQQPQSQDQSIQLANPFSRKLQSSSLAHQIEGIESKQAKKT
DYITDRYIPSRKQSKLNTYQAYECNENYNYYENQFTTDSPRGSSTNSVFVKNAVDKEEIN
QISISQLYKNYVLGIKDKRMLNLSLSSAHAFCPYKNQNVLRFTKPNILKNSMQIGIEANQ
QKSILQSSSAYPNQLFLNLEEEQCCSHLRFSRKISKVPFKVLDAPALQDDFYLNLIDWSS
QNILAVGLSSCVYLWSACSSRVTKLCDFGRTNEVTSVNWSPRSSLISIGTNTGEVEIWDS
VKLEKVRVMKGHSQRVGTLAWNTNILTSGSRDKTILQRDLRTKNLYEQKLIGHKQEVCGL
KWSFDEQQLASGGNDNKLFVWNMHSNKPITKFGNHNAAVKALAWSPHQHGLLVSGGGTQD
RTIRFWNTLTSRQLECIETGSQVCNLIFSKNVNELVSTHGYSQNQIIIWSYPEMEKLITL
TGHSCRVLYLAMSPDGQTIVTGAGDETLRFWNVFPSNKEKQIDDSTSTLLSKNHALR


>TTHERM_01005120(gene)
ATGGATTATCTAGAATTTGGAGGATAAGAATGGTCGCAACCAATGTAAGCGGATATGCTA
TGTAGCAACAATACCAAGCAAAGCTAGTTACTATAAGGAAATCTTTAGGTAATGAAGAAT
GGGTGCGAAATAAATGATAATTAGTCATGGACCACTGACACTTCAATTCCTTCTTAGGAT
ATTGACTATCCGTCAATATCTTACCAAAATAATAAGCTTTCACCCATACATAGCCCACAA
TATTCATAAAATAGCACTCATTTATTTAAGGCGAATTCATTAGAAAACAGCGTTGAAAAT
AGTTACTTCAAAGATAGTATCTCTTCTCCATCTTTCTAGCCTAGCTATTTATCTATGTCT
TAAAGTTATCACTAATCAGCAGGATAGTAGAAATAAATACCTTCTTCTAGTTTTAGAAAG
CAATAACCTTAGAGTTAAGATCAATCTATCTAATTAGCAAACCCTTTTAGCAGAAAATTA
TAGTCTTCATCTTTGGCTCATTAAATAGAAGGTATAGAAAGTAAATAGGCAAAAAAGACT
GACTATATCACTGATAGATATATTCCAAGCAGAAAATAATCTAAATTAAATACTTACTAA
GCTTACGAGTGTAATGAAAACTATAATTATTATGAAAACCAATTTACCACTGATAGTCCC
CGTGGATCTAGCACAAACAGTGTATTTGTAAAAAATGCAGTTGACAAGGAGGAAATAAAC
TAAATCAGTATTTCTCAATTATATAAAAACTATGTTTTGGGTATCAAAGATAAAAGAATG
CTGAATCTTTCTTTAAGTTCTGCTCATGCGTTTTGTCCCTATAAAAACTAGAACGTATTG
CGTTTCACCAAACCAAATATATTAAAGAATAGTATGCAAATAGGTATTGAAGCTAATCAG
CAAAAAAGTATATTGCAGTCATCAAGTGCTTACCCAAATTAGCTATTCCTGAACTTAGAA
GAAGAATAGTGTTGCTCCCATTTGCGCTTTTCCCGTAAAATATCAAAAGTACCATTTAAA
GTTCTAGATGCTCCAGCTCTATAAGATGATTTCTACCTAAATTTAATTGATTGGTCAAGT
TAAAATATTCTTGCAGTCGGTTTATCATCATGCGTTTACTTATGGAGGTAGAGTTTGATT
TTTAGTTATTACTTAATTTTTTAGTATTTGCGTATCCATACACGCAATAGACATTTATTA
GAATTTATTTTTCACTTAATTTGATATAATTTTATTAAAGTCAATTCTTATCTCTAATTT
ACATAATAACTTGGTAATAATCAATTCATCCATTCAATCTATAATTGATTGATTGATTCA
TACATTGAATCTTAGATTTTTAGATTGAATCTATAGGGTTTTTTGAGAGATCTTTATTTT
ATATAGTGATATATAAATCAATTAAATGAGCATAAATAAGCAAATAAAAATAAACATCCC
TTATACATATCAAATACATTAATAAACAAAAATTTATCTTTAATCAATCACATCAGATAT
ATAGGTTTTTCTATCTATTTTAACACAATTTTAAACTTGAGGTTTTTTGTTTGCCTTTCT
TTTGATATTAGATATATAAAAAATAGATACATAAATAAATAGTCAATCAATTAATCAATC
TAACTTGTTAAAGTTAATTAAAAAGAATGTTTACTTAGTTTTTGGTAGGTATATTTTTAT
TAGTTTTTGCAGAAGGTTTTAAAACTCTATATCGATCATATCTTATGATTAAACAAATAA
ATCTTATTTTACTATGTAAATTTTAAATATAGTAATAAATCTACCACTCACTTCTTTTAT
TTTCTTTATCTTTAAAATTAATAGCTAGGCAATTTATTTTTAAATTTTAGATTAAAATTT
ATATTTTAAAATATTTAGTGCATGTTCTTCAAGAGTAACCAAGCTTTGTGATTTTGGAAG
AACAAACGAAGTAACGTCAGTTAATTGGTCACCAAGAAGCTCCCTCATTTCAATTGGTAT
TTTATATTGTATTTATTAATATTAATTAATCTTACAAAAAAAGGTACTAACACTGGAGAA
GTAGAAATATGGGATTCTGTAAAACTAGAAAAAGTGAGAGTTATGAAAGGACATTCATAA
AGAGTTGGAACTCTTGCATGGTAAATAAATACCTTTTAAAATTATTTTTAGATAGAAATC
CAAATAAATATTAAAAAATGTTATTAAATTAAATAGGAATACAAACATTTTAACTAGTGG
TTCTAGAGATAAAACTATATTGCAAAGAGATTTACGTACTAAAAATTTATATGAATAGAA
GTTGATAGGCCATAAATAAGAAGTATGTGGATTAAAATGGTCTTTTGATGAATAGTAACT
TGCTTCAGGAGGAAACGATAATAAGTTATTTGTATGGAATATGCATTCAAACAAACCTAT
TACTAAATTTGGTAATCATAATGCAGCAGTAAAAGCTCTTGCCTGGTCACCTCATTAACA
TGGATTGTTAGTTTCTGGAGGAGGTATTTTAATTAAATTTTTTATTTAATGTTTTTCGAG
CTTGAATAGCTAATTAAATTTCTATCTTAAATAAAAATTAATTATTTGTGACTGGATGAA
TTATTATTGATCATAATAAATTCTCAAATATTAGACTTTTAATTTAATTAATTTTTTAAA
AATTTATCAGGAACACAAGATAGAACCATCAGATTTTGGAATACTCTTACAAGTAGACAA
CTAGAATGTATTGAAACAGGAAGTTAAGTTTGTAACTTGATCTTTAGTAAAAATGTAAAT
GAGCTAGTTAGCACTCATGGATATAGCTAAAACTAAATAATTATATGGAGTTATCCAGAA
ATGGAAAAGCTAATTACTTTAACAGGTCATTCATGCAGAGTTCTTTATTTAGCTATGAGC
CCAGATGGATAAACTATTGTCACAGGTGCTGGTGATGAAACCTTAAGGTTTTGGAATGTC
TTTCCCAGTAACAAGGAAAAATAAATAGATGATTCTACTTCGACTTTACTATCTAAAAAT
CATGCACTAAGATGA