Identifiers and Description

Gene Model Identifier

TTHERM_00526610

Standard Name

FZY3 (FiZzY protein)

Aliases

PreTt06399 | 66.m00198 | 3722.m00056

Description

fizzy/CDC20/CDH1 family protein; homolog of S. cerevisiae CDH1, a cell cycle regulated activator of the anaphase-promoting complex /cyclosome (APC/C), which directs ubiquitination of various targets

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF08662 ) Eukaryotic translation initiation factor eIF2A

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00526610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13405.19.997093137033517e-262hypothetical protein (583 aa)
OxytrichaContig4092.0.g701.999787596754473e-118WD domain, G-beta repeat
WormBaseWBGene000015102.0004261429631518e-110locus:fzr-1 status:Partially
_confirmed UniProt:Q09649
protein_id:CAA87433.1
DictyBaseDDB_G02872592.0008734984431652e-95cdh1 on chromosome: 5 position
54882 to 57146
SGDYGL003C1.0003180480544985e-86CDH1 Cell-cycle regulated acti
vator of the anaphase-promotin
g complex/cyclosome (APC/C), w
hich directs ubiquitination of
cyclins resulting in mitotic
exit; targets the APC/C to spe
cific substrates including Cdc
20p, Ase1p, Cin8p and Fin1p
Stentor CoeruleusSteCoe_283332.0842828425817514e-52

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000045

Sequences

>TTHERM_00526610(coding)
ATGGATATCGAAAGCCTCCTTTCCTCTCTCTCCTTCGAAGAGAGCCAATAGCAATAGCAC
TAGTTTGATGCTCTTGACTTCTAATTACAGCCATAGCTCAGCTCCTAAAGCAGCACTTCT
ATTTCCTCTTCTTACTCACTATCTTCTCCTAGCTATTAGTAGCACTATCAATAATAAATA
CCTTCCTAGTAGGATTGCTTCAGCAGCATGCATCTTGCCAAACAAAGCAGTAGCATTTCC
AGTTGCAGCACTAGCAGCAGTGCTTGGAGTGACTCCCGCTTCATTCCATCTAGAAAACAG
TCTAAGTATAATGTCATGCTTAGCAGCGCACATGAAGTTAAGATGTAGAAGAGCACAAAA
GGGTAATTTTTACATGATGAAAACGACATCAGTATAGCCCAGCTTTATAAGAAACATGTC
CTTGAGTTGAATAATAGCAAAAATGAAAATAAATTGCATTTTTGTGATTCTAAAGTAAGC
AATAAATAATTTGGTCGCAAAGGAAACAAAGCCAGTGCTGCTTCCTCTAATTCATTATCT
GCTGCTTTGCCTTATGGACCAGATTCTAACATGCTTCTAAACAATGAAAATAGCTGCAAT
GGATTAGAATCTATGATTTTGAGCATGCAAAAAACCTAGGCACAGCACCGTATTAATGAA
TAACTCTCTGCTAGCAATTCTTCATCGTTCTCTCGTAAGTAAAACCAGATCAGCTATAGC
CAAATTAAAGTTTTAGATGCACCAGGATTAATCGATGACTTCTACTTGAACCTTTTAGAT
TGGAGTTAGCGCAATTTGCTAGCTGTTGCTTTAGGAAGCACTGTTTATGTTTGGAATGGT
TAAAATAACTAAGTTCTTAAAATGTGTGACGTTACTAAAATCCCTAATCCCCTTATACAA
GACTAAAGTCCTCACGTCCTTGAGTAGAACAAAGTTCAATCAATTTAATGGAGTTAAAGT
GGTAATTTGCTTGGTGTTGGAGATGCAAATGGTATTATTTCTATTTATGACTTGCATACT
CAAAAGCGTCTTAACTCTTTGCCTCTCCATACAGACAGAATAGGAAGTCTTGCCTGGAGA
GATGATTTCATCGTTGCTAGTGGTAGTAGGGATAAATCAATATTCTGCACAGATATTAGA
ATTTCCACTCCTTCTAACAAGAGATGTATCTAAAGGTTTACAGGACATAAACAAGAAGTC
TGCGGTTTAAAATGGTCATTTGACCACTAAATGCTAGCTAGTGGAGGCAACGATAACAAA
CTTTTTGTATGGTCTTTACGTACTTCTACACATATAAATAAATTTTAGGAACACAAGGCC
GGAGTAAAAGCTATAGCATGGTCTCCTCATTAGCATGGATTGCTGGTTTCTGGTGGTGGT
ACTGCTGATAGAACTATTCGTTTCTGGAACACTTAGCTTGGCGAGCAAGTAGACTGCATT
GAAGTCAACAGCTAAGTCTGTAATTTAGTTTTTTCAAAAAATGAAAACGAATTTGTTAGC
ACTCATGGATTCCAAGATAATGATATTATAGTATGGAAATATCCTACTCTATAAAAAATA
GCTTGCCTTACAGGTCATACATGTCGTGTGCTCTAGCTCGGACTCAGTCCTTGTAGCACT
AAAATTGTCACAGGAGCAGGAGATGAAACATTAAGATTTTGGGATGTATTTAAGTCTAAC
AAGAACGTCCCTAACAAGTAAGGTTCTCTCCTAGACACAAAGGTTGATCTCCGCTGA


>TTHERM_00526610(protein)
MDIESLLSSLSFEESQQQQHQFDALDFQLQPQLSSQSSTSISSSYSLSSPSYQQHYQQQI
PSQQDCFSSMHLAKQSSSISSCSTSSSAWSDSRFIPSRKQSKYNVMLSSAHEVKMQKSTK
GQFLHDENDISIAQLYKKHVLELNNSKNENKLHFCDSKVSNKQFGRKGNKASAASSNSLS
AALPYGPDSNMLLNNENSCNGLESMILSMQKTQAQHRINEQLSASNSSSFSRKQNQISYS
QIKVLDAPGLIDDFYLNLLDWSQRNLLAVALGSTVYVWNGQNNQVLKMCDVTKIPNPLIQ
DQSPHVLEQNKVQSIQWSQSGNLLGVGDANGIISIYDLHTQKRLNSLPLHTDRIGSLAWR
DDFIVASGSRDKSIFCTDIRISTPSNKRCIQRFTGHKQEVCGLKWSFDHQMLASGGNDNK
LFVWSLRTSTHINKFQEHKAGVKAIAWSPHQHGLLVSGGGTADRTIRFWNTQLGEQVDCI
EVNSQVCNLVFSKNENEFVSTHGFQDNDIIVWKYPTLQKIACLTGHTCRVLQLGLSPCST
KIVTGAGDETLRFWDVFKSNKNVPNKQGSLLDTKVDLR


>TTHERM_00526610(gene)
ATGGATATCGAAAGCCTCCTTTCCTCTCTCTCCTTCGAAGAGAGCCAATAGCAATAGCAC
TAGTTTGATGCTCTTGACTTCTAATTACAGCCATAGCTCAGCTCCTAAAGCAGCACTTCT
ATTTCCTCTTCTTACTCACTATCTTCTCCTAGCTATTAGTAGCACTATCAATAATAAATA
CCTTCCTAGTAGGATTGCTTCAGCAGCATGCATCTTGCCAAACAAAGCAGTAGCATTTCC
AGTTGCAGCACTAGCAGCAGTGCTTGGAGTGACTCCCGCTTCATTCCATCTAGAAAACAG
TCTAAGTATAATGTCATGCTTAGCAGCGCACATGAAGTTAAGATGTAGAAGAGCACAAAA
GGGTAATTTTTACATGATGAAAACGACATCAGTATAGCCCAGCTTTATAAGAAACATGTC
CTTGAGTTGAATAATAGCAAAAATGAAAATAAATTGCATTTTTGTGATTCTAAAGTAAGC
AATAAATAATTTGGTCGCAAAGGAAACAAAGCCAGTGCTGCTTCCTCTAATTCATTATCT
GCTGCTTTGCCTTATGGACCAGATTCTAACATGCTTCTAAACAATGAAAATAGCTGCAAT
GGATTAGAATCTATGATTTTGAGCATGCAAAAAACCTAGGCACAGCACCGTATTAATGAA
TAACTCTCTGCTAGCAATTCTTCATCGTTCTCTCGTAAGTAAAACCAGATCAGCTATAGC
CAAATTAAAGTTTTAGATGCACCAGGATTAATCGATGACTTCTACTTGAACCTTTTAGAT
TGGAGTTAGCGCAATTTGCTAGCTGTTGCTTTAGGAAGCACTGTTTATGTTTGGAATGGT
TAAAATAACTAAGTTCTTAAAATGTGTGACGTTACTAAAATCCCTAATCCCCTTATACAA
GACTAAAGTCCTCACGTCCTTGAGTAGAACAAAGTTCAATCAATTTAATGGAGTTAAAGT
GGTAATTTGCTTGGTGTTGGAGATGCAAATGGTATTATTTCTATTTATGACTTGCATACT
CAAAAGCGTCTTAACTCTTTGCCTCTCCATACAGACAGAATAGGAAGTCTTGCCTGGAGA
GATGATTTCATCGTTGCTAGTGGTAGTAGGGATAAATCAATATTCTGCACAGATATTAGA
ATTTCCACTCCTTCTAACAAGAGATGTATCTAAAGGTTTACAGGACATAAACAAGAAGTC
TGCGGTTTAAAATGGTCATTTGACCACTAAATGCTAGCTAGTGGAGGCAACGATAACAAA
CTTTTTGTATGGTCTTTACGTACTTCTACACATATAAATAAATTTTAGGAACACAAGGCC
GGAGTAAAAGCTATAGCATGGTCTCCTCATTAGCATGGATTGCTGGTTTCTGGTGGTGGT
ACTGCTGATAGAACTATTCGTTTCTGGAACACTTAGCTTGGCGAGCAAGTAGACTGCATT
GAAGTCAACAGCTAAGTCTGTAATTTAGTTTTTTCAAAAAATGAAAACGAATTTGTTAGC
ACTCATGGATTCCAAGATAATGATATTATAGTATGGAAATATCCTACTCTATAAAAAATA
GCTTGCCTTACAGGTCATACATGTCGTGTGCTCTAGCTCGGACTCAGTCCTTGTAGCACT
AAAATTGTCACAGGAGCAGGAGATGAAACATTAAGATTTTGGGATGTATTTAAGTCTAAC
AAGAACGTCCCTAACAAGTAAGGTTCTCTCCTAGACACAAAGGTTGATCTCCGCTGA