Identifiers and Description

Gene Model Identifier

TTHERM_00160770

Standard Name

FTT49 (14-3-3 protein)

Aliases

PreTt28469 | 13.m00428 | 3829.m01285

Description

14-3-3 protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00244 ) 14-3-3 protein
  • ( PF07719 ) tetratricopeptide repeat
  • ( TIGR00149 ) conserved hypothetical protein TIGR00149

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00160770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05334.13.9999205845932763e-15614-3-3 family protein (302 aa)
DictyBaseDDB_G02691386.002136614931438e-113fttB on chromosome: 1 position
3949672 to 3950633
SGDYDR099W5.997605038815675e-110BMH2 14-3-3 protein, minor iso
form; controls proteome at pos
t-transcriptional level, binds
proteins and DNA, involved in
regulation of many processes
including exocytosis, vesicle
transport, Ras/MAPK signaling,
and rapamycin-sensitive signa
ling
OxytrichaContig938.1.g1383.999200205084497e-10114-3-3 protein
WormBaseWBGene000015021.9995541014149208e-99locus:ftt-2 14-3-3-like prot
ein 2 status:Confirmed Uni
Prot:Q20655 protein_id:CAA91
474.1
Stentor CoeruleusSteCoe_33095.5210822770285325e-42

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00160770(coding)
ATGTCCAACCATACCAGAGAAGAACTCATCTACTTGGCCAAGATCTCCGAATAAACTGAA
AGATTCGAAGATATGCTTGAAAACATGAAATAGGTTGTTAAAATTGAATAAGAACTTTCC
GTTGAAGAAAGAAACTTACTCTCTGTTGCTTATAAGAACACCGTTGGTTCCAGAAGAACT
GCCTGGAGAGCCATCTCTTCCATTGAACAAAAGGAAGAATCTAAGGGTTCTAAGCACATC
AGCCTCCTTAAGGACTACAAGAAAAAGATTGAAGGTGAACTCTCCAACTTCTGTAACGAT
ATTCTTGAACTTTTGGACAACCACCTCATTAGCAAGAGCAACTCTAACGAAGCTAAGGTC
TTCTTCTTAAAGATGAAGGGTGATTACTACAGATACATCGCTGAATACGCTTCTGGCAAC
ACCCACGACGAAGCTGCCAACGGTGCCCTCCAAGCTTACAAGCAAGCTTCCGATATTGCC
ACCAAGGAATTAAATACCACTCACCCCATCAGATTAGGTTTGGCTCTTAACTTCTCCGTC
TTCTACTACGAAGTTATGAACGACCCCACCAAGGCCTGCAACTTAGCTAAGCAAGCTTTC
GATGATGCCATCGCTGACATTGAACACATCGAAGAAGACTAGTACAAGGATGCCACCACC
ATTATGCAATTAATCAGAGATAACCTCACCCTCTGGACCTCTGAACTCCAAAATGACGAC
GAAGGTGGTGATGCTCAAGTTGAAAACATCTGA


>TTHERM_00160770(protein)
MSNHTREELIYLAKISEQTERFEDMLENMKQVVKIEQELSVEERNLLSVAYKNTVGSRRT
AWRAISSIEQKEESKGSKHISLLKDYKKKIEGELSNFCNDILELLDNHLISKSNSNEAKV
FFLKMKGDYYRYIAEYASGNTHDEAANGALQAYKQASDIATKELNTTHPIRLGLALNFSV
FYYEVMNDPTKACNLAKQAFDDAIADIEHIEEDQYKDATTIMQLIRDNLTLWTSELQNDD
EGGDAQVENI


>TTHERM_00160770(gene)
ATGTCCAACCATACCAGAGAAGAACTCATCTACTTGGCCAAGATCTCCGAATAAACTGAA
AGATTCGAAGATATGCTTGAAAACATGAAATAGGTTGTTAAAATTGAATAAGAACTTTCC
GTTGAAGAAAGAAACTTACTCTCTGTTGCTTATAAGAACACCGTTGGTTCCAGAAGAACT
GCCTGGAGAGCCATCTCTTCCATTGAACAAAAGGAAGAATCTAAGGGTTCTAAGCACATC
AGCCTCCTTAAGGACTACAAGAAAAAGATTGAAGGTGAACTCTCCAACTTCTGTAACGAT
ATTCTTGAACTTTTGGACAACCACCTCATTAGCAAGAGCAACGTAAACCCATTTTTCAAT
TTCAAAAACATCATTTCTTTAATGTATCCCATTCATTACAAACATACTTTTGCCGCGATA
AACCTTTTTCAAATCAAGTTAGAGATGTAGAAAATAACAAAAATAATATCAAAAGCTGAC
TGTTTGACTGACTAACAATCTCATTAGCTTTAAATAGGTACATAAGACATTTAAAGGTAT
CTATCCTTTGAATAGGAACTGATTTAAGAACAGAATTCTATTCATCCATATTTATATTAA
ACATAAAAAGATAAACAAAAAAAAAGAAATTAAATCCTAACTTAAAGCTTTACCAATAAT
AAATAACTCAATTAAGGTTATAAGTATTCAGTCATTGTAAATGAAGACCAAAGCTACTTA
CAAATGACTGATAGCTAATTAAGCAATTATTTTTACATCAATTTTTATAAAGCAAATAGC
TTTTTAGCGAATATATTTAGAATAAATAACTCTAAATTAGAAATACCAAGTAGCAAGAAG
GAAAAAATAAAATATTCAAATTAATCAGTCAGTCAGTTAGTTAGTTTATCAGTCTACCTA
AGATACTCAAACAAACAAATAAATTATATAAAAAGGACTAACAAAACTAAAATATAAAAA
TCAAATAAAATTTTTTTCAAATAGATATAAAATATCTTCATAATCGCAAAATATCTCATG
ATTAAACAGATATCATATTTTAAAAATATGTGAATAGACAAAATATATTAAAACTTTTAT
ATTTAAAATAAATAGTCTAACGAAGCTAAGGTCTTCTTCTTAAAGATGAAGGGTGATTAC
TACAGATACATCGCTGAATACGCTTCTGGCAACACCCACGACGAAGCTGCCAACGGTGCC
CTCCAAGCTTACAAGCAAGCTTCCGATATTGCCACCAAGGAATTAAATACCACTCACCCC
ATCAGATTAGGTTTGGCTCTTAACTTCTCCGTCTTCTACTACGAAGTTATGAACGACCCC
ACCAAGGCCTGCAACTTAGCTAAGCAAGCTTTCGATGATGCCATCGCTGACATTGAACAC
ATCGAAGAAGACTAGTACAAGGATGCCACCACCATTATGCAATTAATCAGAGATAACCTC
ACCCTCTGGACCTCTGAACTCCAAAATGACGACGAAGGTGGTGATGCTCAAGTTGAAAAC
ATCTGA