Identifiers and Description

Gene Model Identifier

TTHERM_00216010

Standard Name

FTT18 (14-3-3 protein)

Aliases

18.m00476 | PreTt22226 | PreTt22225 | 3701.m00014

Description

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00216010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06568.13.0002313851495736e-15514-3-3 family protein (245 aa)
SGDYER177W6.00054123732624e-104BMH1 14-3-3 protein, major iso
form; controls proteome at pos
t-transcriptional level, binds
proteins and DNA, involved in
regulation of many processes
including exocytosis, vesicle
transport, Ras/MAPK signaling,
and rapamycin-sensitive signa
ling
OxytrichaContig938.1.g1389.99679536751975e-10314-3-3 protein
DictyBaseDDB_G02691381.9998944264638884e-101fttB on chromosome: 1 position
3949672 to 3950633
WormBaseWBGene000015023.9981372112117256e-92locus:ftt-2 14-3-3-like prot
ein 2 status:Confirmed Uni
Prot:Q20655 protein_id:CAA91
474.1
Stentor CoeruleusSteCoe_29433.0144087850653746e-40

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00216010(coding)
ATGTCTTTATCTAGAGAAGAAAATATTTACATGGGTAAGATTTCGGAACAAACCGAAAGA
TTCGAAGATATGTTAGAATACATGAAGAAGGTTGTTCAAACTGGTTAGGAATTATCCGTT
GAAGAAAGAAACCTTCTCTCTGTTGCTTACAAGAACACCGTTGGTTCTCGTAGATCTGCC
TGGAGAAGTATCTCTGCCATCCAACAAAAGGAAGAATCCAAGGGATCTAAGCACCTCGAC
CTCCTCACCAACTATAAGAAGAAGATCGAAACTGAACTTAACCTTTACTGCGAAGATATC
CTCAGACTCCTCAACGATTACCTCATCAAGAATGCCACCAACGCTGAAGCTCAAGTTTTC
TTCTTGAAGATGAAGGGTGATTACTACAGATATATTGCTGAATACGCCTAAGGTGACGAC
CACAAGAAGGCTGCCGATGGTGCCTTGGACTCCTACAATAAGGCTTCTGAAATCGCCAAC
TCTGAATTGAGCACCACTCACCCCATCAGATTAGGTTTGGCTCTTAACTTCTCCGTTTTC
CACTACGAAGTCTTGAATGACCCCTCCAAAGCCTGCACCTTGGCTAAGACTGCTTTCGAT
GAAGCTATTGGTGATATCGAAAGAATCTAAGAAGACTAATATAAGGATGCCACCACCATT
ATGCAATTAATTAGAGATAACCTCACCCTCTGGACTTCTGAATTCCAAGACGATGCTGAA
GAATAATAAGAATGA


>TTHERM_00216010(protein)
MSLSREENIYMGKISEQTERFEDMLEYMKKVVQTGQELSVEERNLLSVAYKNTVGSRRSA
WRSISAIQQKEESKGSKHLDLLTNYKKKIETELNLYCEDILRLLNDYLIKNATNAEAQVF
FLKMKGDYYRYIAEYAQGDDHKKAADGALDSYNKASEIANSELSTTHPIRLGLALNFSVF
HYEVLNDPSKACTLAKTAFDEAIGDIERIQEDQYKDATTIMQLIRDNLTLWTSEFQDDAE
EQQE


>TTHERM_00216010(gene)
ATGTCTTTATCTAGAGAAGAAAATATTTACATGGGTAAGATTTCGGAACAAACCGAAAGA
TTCGAAGATATGTTAGAATACATGAAGAAGGTTGTTCAAACTGGTTAGGAATTATCCGTT
GAAGAAAGAAACCTTCTCTCTGTTGCTTACAAGAACACCGTTGGTTCTCGTAGATCTGCC
TGGAGAAGTATCTCTGCCATCCAACAAAAGGAAGAATCCAAGGGATCTAAGCACCTCGAC
CTCCTCACCAACTATAAGAAGAAGATCGAAACTGAACTTAACCTTTACTGCGAAGATATC
CTCAGACTCCTCAACGATTACCTCATCAAGAATGCCACCGTAAGCTACATTTTATTCTAT
TGGCTTTCTACTCATTTTTCATATATTTTTATTCACTCATCCAACCATCTTCTACACATA
AGTATGTCTTCTTAACATAAGTGTTTTCATTCAAATCAGTAAAGATTGACTCCAATTTTA
AGTGGAGCCCATAGTCCTTTATTTGAATTAAATAACTTATCGCTACCCTCAAATGAGAGT
AAGACGTCTTTTAATTTTTTCTTCATACCTTATTTTTGAAGAACAAAATTTAAAAAGAAA
TTAAGAAGCAAGTAAGAAGATAAATAGGAGCTTTATAGTAAAATGGAGTTGATTTAATTG
ATACTACATACCCAATACTCATTAATTTATGAGATTGTTAGTATCTTCAAATAAGCTTAC
AATTTTACTTATGTGTGTCTGAATATGACTAACATTTTTTGTAGTAAGCGGTCAACTACA
TTACTCTAAGTTAGGAAAATAAATCAATAAAACAAAGAGGATTGTATCTTTTCTTTAAGA
TAGTAAATAATCTTAATTGAATAGAATGCCTCAAAAATACTCTCCTAACAGTTTTAAATA
CTTTTTTCTTTTTTTCTCTTAGCTTCATCAATTTCAAAATAAAATAAAATAAATACGAAA
GAAGTCAATCAACTTACTTGACCTTTCTTTTCATAAATTATATCATCATCAAAGATGATT
TAGTTACTGAGTGAGTGAGTGAGTGAATACGATTTAACCCAATATACTTCTTCTCAAAAA
TTATTGTTTTAATTATCTTCTACTGCTACTGTACCCTATAGCTAGATGCTTAGCCAGTCA
GTAAGTCAGTTAGTTAGTGAGGAAAAATCATGTTTTTATAGCAAAAAAAGTAAAGATGCT
TACATGCAAACTTTATTTAATCAAATAAAAAGAGAAGTATATTCGGCCATTAATGATTAA
TAAATTAGAGAAAGCACATACAATATATTATTCATCCATACTAATCTTCTTTTTAAATAA
ATAGAACGCTGAAGCTCAAGTTTTCTTCTTGAAGATGAAGGGTGATTACTACAGATATAT
TGCTGAATACGCCTAAGGTGACGACCACAAGAAGGCTGCCGATGGTGCCTTGGACTCCTA
CAATAAGGCTTCTGAAATCGCCAACTCTGAATTGAGCACCACTCACCCCATCAGATTAGG
TTTGGCTCTTAACTTCTCCGTTTTCCACTACGAAGTCTTGAATGACCCCTCCAAAGCCTG
CACCTTGGCTAAGACTGCTTTCGATGAAGCTATTGGTGATATCGAAAGAATCTAAGAAGA
CTAATATAAGGATGCCACCACCATTATGCAATTAATTAGAGATAACCTCACCCTCTGGAC
TTCTGAATTCCAAGACGATGCTGAAGAATAATAAGAATGA