Identifiers and Description

Gene Model Identifier

TTHERM_00592720

Standard Name

FTT1 (Fourteen-Three-Three 1)

Aliases

PreTt25025 | 82.m00115 | 3835.m00525

Description

14-3-3 protein; involved in vesicular trafficking and polyglycylation, a post-translational modification process in tubulin subunits

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00592720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07541.16.002196208547375e-16614-3-3 family protein (247 aa)
OxytrichaContig938.1.g1385.001369568193564e-7314-3-3 protein
SGDYDR099W2.9997879492220375e-71BMH2 14-3-3 protein, minor iso
form; controls proteome at pos
t-transcriptional level, binds
proteins and DNA, involved in
regulation of many processes
including exocytosis, vesicle
transport, Ras/MAPK signaling,
and rapamycin-sensitive signa
ling
DictyBaseDDB_G02691388.001396889359552e-66fttB on chromosome: 1 position
3949672 to 3950633
WormBaseWBGene000015028.000035279590482e-64locus:ftt-2 14-3-3-like prot
ein 2 status:Confirmed Uni
Prot:Q20655 protein_id:CAA91
474.1
Stentor CoeruleusSteCoe_29432.9374821117108028e-30

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000385

Sequences

>TTHERM_00592720(coding)
ATGGCTGATAATAAAAGAGAAGAGTACATTTACATGGCAAAACTATCTGAGTAAACAGAA
AGGTTTGACGAAATGGTAGAGTATACTAAAAAGTTAGTTGGGTTATCAAGAGAATTAAAA
GATGAAGAAAGAAATCTTTTATCTATTGCTTATAAAAATTATGTTTCGTAAAGAAGGACT
GCGTGGAGAGCAATTACAGCTTACGAAACAAAGGAAAAGAATAAAAATACCTTGGGTAAA
TATGCAGAAACAATTAGATATTATAAAAAAAATATTGAAGAAGAAATGGAGAAAAGTTGC
AATGAAATTATTTAAATCCTTGATGAAACACTCATCAAAAATTCTAATCAAGACGCTAAA
ATTTTCTACTTAAAAATGAGGGGGGATTATTACAGATATTTATGCGAGTTTAGCTCACCC
GATCAATTAGAAACATACACATCTGAAGCCATTCAATCCTACGAAGAAGCCAACCAATTA
TTGGATTAAAAAAATGCAAGAAAAGATGATGCCTTACGTCTAGGTATTGCACTCAACTAT
TCTGTCCTTTACTATGAAATCAAGGATGATATAGTTAAGGCATGTGAAATAGCCAGAAAA
GCTTTCCAAGAAGCCCTTAATGACCTTGAAGATTTGGAAGAAGAAAGGTATAAAGATTCG
ACAACAATTATGTAGCTTATTAGAGACAATCTCACAGTTTGGTAAAATGAACTCCCAGAG
GGGTAAGACAGAAACAAGTGA


>TTHERM_00592720(protein)
MADNKREEYIYMAKLSEQTERFDEMVEYTKKLVGLSRELKDEERNLLSIAYKNYVSQRRT
AWRAITAYETKEKNKNTLGKYAETIRYYKKNIEEEMEKSCNEIIQILDETLIKNSNQDAK
IFYLKMRGDYYRYLCEFSSPDQLETYTSEAIQSYEEANQLLDQKNARKDDALRLGIALNY
SVLYYEIKDDIVKACEIARKAFQEALNDLEDLEEERYKDSTTIMQLIRDNLTVWQNELPE
GQDRNK


>TTHERM_00592720(gene)
ATGGCTGATAATAAAAGAGAAGAGTACATTTACATGGCAAAACTATCTGAGTAAACAGAA
AGGTTTGACGAAATGGTAGAGTATACTAAAAAGTTAGTTGGGTTATCAAGAGAATTAAAA
GATGAAGAAAGAAATCTTTTATCTATTGCTTATAAAAATTATGTTTCGTAAAGAAGGACT
GCGTGGAGAGCAATTACAGCTTACGAAACAAAGGAAAAGAATAAAGTATGTAAAATTTTA
ATAGAATTAACTAGTAAAATATTTTAAAACTGATATATAACAGAATACCTTGGGTAAATA
TGCAGAAACAATTAGATATTATAAAAAAAATATTGAAGAAGAAATGGAGAAAAGTTGCAA
TGAAATTATTTAAATCCTTGATGAAACACTCATCAAAAATTCTAATCAAGACGCTAAAAT
TTTCTACTTAAAAATGAGGGGGGATTATTACAGATATTTATGCGAGTTTAGCTCACCCGA
TCAGTAATTGACATATATTTAATCAAAATTTTATTCAAAAAATAGACATCATTAAATAAA
AATGAATGTAAATGAACCAATCTGAATCAAATTTTAATCTTAACAAATTACATTGTCATT
ATTAACTTTATCTCTATCAAATAGATTAGAAACATACACATCTGAAGCCATTCAATCCTA
CGAAGAAGCCAACCAATTATTGGATTAAAAAAATGCAAGAAAAGATGATGCCTTACGTCT
AGGTTATTTATTTACTTATTTAAATTATATAGTAAATACAAATAAATCTATTTATTTATT
TAATTACACATCAACTGCAAATTAAAATAATTGAAACGATTAATTATATTCATTCATTCA
TGTATGCATTTATTCATAGATTGTTTAAAATATAAGGTATTGCACTCAACTATTCTGTCC
TTTACTATGAAATCAAGGATGATATAGTTAAGGCATGTGAAATAGCCAGAAAAGCTTTCC
AAGAAGCCCTTAATGACCTTGAAGATTTGGAAGAAGAAAGGTATAAAGATTCGACAACAA
TTATGTAGCTTATTAGAGACAATCTCACAGTTTGGTAAAATGAACTCCCAGAGGTAAAAG
CTTACATTTGGAACAAAAATGATTAATAAATATTTAAATAAATAATAAAATAATATTTAG
GGGTAAGACAGAAACAAGTGA