Identifiers and Description

Gene Model Identifier

TTHERM_00295700

Standard Name

FSF1 (Formaldehyde dehydrogenase/S-formylglutathione hydrolase fusion protein)

Aliases

PreTt15680 | 27.m00340 | 3692.m00143

Description

Formaldehyde dehydrogenase/S-formylglutathione hydrolase fusion protein; fusion protein containing two enzymes known to catalyze sequential steps in the formaldehyde detoxification pathway in yeast; this fusion unique to ciliates

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00756 ) putative esterase
  • ( TIGR01751 ) crotonyl-CoA reductase
  • ( TIGR00692 ) L-threonine 3-dehydrogenase
  • ( TIGR02821 ) S-formylglutathione hydrolase
  • ( TIGR01202 ) Chlorophyll synthesis pathway, bchC
  • ( PF08240 ) Alcohol dehydrogenase GroES-like domain
  • ( PF00326 ) peptidase, S9A/B/C familie, catalytic domain
  • ( PF00107 ) oxidoreductase, zinc-binding dehydrogenase family
  • ( TIGR02822 ) zinc-binding alcohol dehydrogenase family protein
  • ( TIGR02819 ) formaldehyde dehydrogenase, glutathione-independent
  • ( TIGR03201 ) 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase
  • ( TIGR03366 ) putative phosphonate catabolism associated alcohol
  • ( TIGR02825 ) leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase
  • ( TIGR02818 ) S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.1%

TetraMine Data

TTHERM_00295700

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08836.19.997093137033517e-262alcohol dehydrogenase (684 aa)
OxytrichaContig9574.0.0.g639.997093137033517e-262Putative esterase
WormBaseWBGene000192401.000274544751666e-156Alcohol dehydrogenase class-3
status:Confirmed UniProt:Q
17335 protein_id:CCD72435.1
DictyBaseDDB_G02818652.9986999840889833e-149adh5 on chromosome: 3 position
5043162 to 5044640
SGDYDL168W1.99904246446894e-143SFA1 Bifunctional enzyme conta
ining both alcohol dehydrogena
se and glutathione-dependent f
ormaldehyde dehydrogenase acti
vities, functions in formaldeh
yde detoxification and formati
on of long chain and complex a
lcohols, regulated by Hog1p-Sk
o1p

General Information

Paragraph NoGene NameParagraph Text
14FSF1A macronuclear chromosome containing a fusion gene was cloned from the spirotrichous ciliate Oxytricha trifallax. The gene encodes a single polypeptide containing homologs of two proteins that catalyze sequential steps in the formaldehyde detoxification pathway in Saccharomyces cerevisiae. These two proteins are formaldehyde dehydrogenase (FALDH) and S-formylglutathione hydrolase (SFGH); the fusion gene is called FSF1 (FALDH/SFGH Fusion 1). A similar gene was identified in the Tetrahymena thermophila genome sequence, and a T. thermophila EST sequenced from both ends showed that the fusion gene is expressed in this species in vivo. FSF1 has not yet been identified in other ciliates, but a fusion of these two genes has been identified in another group of protists, the diatoms. An EST from Phaeodactylum tricornutum and a gene from the genome sequence of Thalassiosira pseudonana both encode a fusion of these two genes, but in the opposite orientation of the ciliate genes. In diatoms, the SFGH domain is found N-terminal to the FALDH domain, suggesting that these two fusion genes evolved independently in ciliates and diatoms. The diatom genes were named SFF1 to highlight these differences.

Associated Literature

  1. Ref:15858209: Stover NA, Cavalcanti AR, Li AJ, Richardson BC, Landweber LF (2005) Reciprocal fusions of two genes in the formaldehyde detoxification pathway in ciliates and diatoms. Molecular biology and evolution 22(7):1539-42
  2. Ref:SUPR000381

Sequences

>TTHERM_00295700(coding)
ATGGACGCATCTTTACTCTCTGAATTCCTTAAAACTGCTGGCCAAACCATCACTTGTAAG
GCTGCTGTAGCTTGGGAAGCTAACAAACCTTTAGATTACACTGACATTTAAGTTGCTCCT
CCTAAGAAAGGAGAAGTTCGTATTAAAGTTTTTGCAAATGCTCTTTGCCATACTGATATT
TACACCTTAGAAGGACACGATCCTGAAGGTCTTTTCCCAAGCATTCTTGGTCATGAAGGT
ACAGGTATTGTTGAAAGTATTGGTGAAGGAGTTACTTCTGTTAAGCCTGGTGATATTGTT
ATTCCTTGCTACACACCTGAATGCAGGGAATTCTCTTGTATTTATTGTAACAATGAAAAC
ACTAACCTTTGTCCTAAGATTAGAGCCTTCTAAGGAAAGGGTTTGATGCCTGATGGTACA
AGCAGATTTTCTAAGGATGGTAAAACTATCTATCACTTTATGGGGTGTTCTAGTTTCTCT
GAATACACAGTTGTTGCTGAAATTTCTTGTGCTAAAGTTAGCGACAAGATTGATGTTAAC
CAAATGTGTCTTTTGGGTTGTGGTATCAGCACTGGTTGGGGTGCTGCAATTAATACTTGC
AAAGTAAGACCTGGATCAACAGTTGTCGTATTTGGTCTTGGTGCAGTTGGTTTAGCAGTA
GTTCAAGCTGCTAAAATTAAAGGAGCAAGAAAAATTGTTGGTATTGATCTTAACAGTGAA
AAATTCACTTTAGCTAAAGATTTCGGTTGCACTGAATGCTGGAATCCTAAAGAGTTGGAC
GGTAAGACCATTAAGGAACACCTTATTTCCTTAGAACCTTGGGGTTATGATTTCACATTT
GATTGCACTGGTATCACTGCTGTTATGAGAGATGCTTTAGAAATTGCTCACAGAGGATTT
GGTGAAAGTTGCGTTATTGGTGTTGCTGCTTCTGGTCATGAAATTTCTACTAGACCATTC
TAATTAGTTACTGGTAGATAATGGAAAGGAACTGCCTTTGGTGGATGGAAAAGCAGAACT
GAAGTTCCCTAATTAGTTTAACAAGTATCTACTGGGGAATTGCCAATTCAAAAATACATT
ACTCATGAAATTAAGGGCTTACAAAATGTCAACTAAGCTATTGATGCTTTACACTCAGGA
AAATGCTTGCGTGCAGTTGTTCATATCAACGAAAGACCTGATTTCAACAAAGAATAGGTA
TCAAAGTTAGTCCCTCGTGTTTATTCTAATGCAAGAAGTCATAATGGATGGGTAAAGAGA
GTAAAGCATTATTCTGAATCTCTTTAATGCGAAATGCAATTTTCAATTTACATCCCTGAT
AAGAAGTCTCGTAATGCTTAACTTCCCCCTGTTCTTTATTATCTTAGTGGACTTACTTGC
ACTGATGAAAACGCTTTGGTAAAATCTGGCTTCTAAAGATATGCCTCTGAACTCGGTATT
GCTGTTGTATTCCCTGACACCTCACCTCGTGTTGATATTGAAGGTGATAACGAAAGTTGG
GACTTTGGTAAATCAGCTGGATTCTACTTAAATGCTACTTAAGAAAAATGGAGAAAGAAC
TACAATATGTTCACCTATATCTCTGAAGAATTACCAAAATTGATTGGAGAATTCTTCCCT
GTTGATGTAAGCAGAGCTGGTATTACTGGTCACTCTATGGGTGGTATGGGAGCTCTTAAC
ATATTCTTAAAGAACCCAGGTAAATATTTGAGTGTCTCTGCCTTTGCTCCTATTTGCAAT
CCCACTTAGTGCCCTTGGGGAGTTAAGGCTTTCACTAACTATTTAGGCTCTGTAGAAGCT
GGTAAATAGTATGATCCAACTGAACTTATTGTTTAATATAATGGTCCCAAGGCTAAGATT
TTAATTGATCAAGGTACTCATGACTCATTCCTTTACAATTAACTTCATCCTTAAAATTTC
TTAAAGGCTGCATCTTCAGTTAATTACCCTGTTGAATTCAGATATCAAAATAACTATGAT
CACCTCTACTTCTTTGTAGAGACCTTCATGGGAGATCATTTCAAGCACCATGCTTAATAT
CTTCTTAGATGA


>TTHERM_00295700(protein)
MDASLLSEFLKTAGQTITCKAAVAWEANKPLDYTDIQVAPPKKGEVRIKVFANALCHTDI
YTLEGHDPEGLFPSILGHEGTGIVESIGEGVTSVKPGDIVIPCYTPECREFSCIYCNNEN
TNLCPKIRAFQGKGLMPDGTSRFSKDGKTIYHFMGCSSFSEYTVVAEISCAKVSDKIDVN
QMCLLGCGISTGWGAAINTCKVRPGSTVVVFGLGAVGLAVVQAAKIKGARKIVGIDLNSE
KFTLAKDFGCTECWNPKELDGKTIKEHLISLEPWGYDFTFDCTGITAVMRDALEIAHRGF
GESCVIGVAASGHEISTRPFQLVTGRQWKGTAFGGWKSRTEVPQLVQQVSTGELPIQKYI
THEIKGLQNVNQAIDALHSGKCLRAVVHINERPDFNKEQVSKLVPRVYSNARSHNGWVKR
VKHYSESLQCEMQFSIYIPDKKSRNAQLPPVLYYLSGLTCTDENALVKSGFQRYASELGI
AVVFPDTSPRVDIEGDNESWDFGKSAGFYLNATQEKWRKNYNMFTYISEELPKLIGEFFP
VDVSRAGITGHSMGGMGALNIFLKNPGKYLSVSAFAPICNPTQCPWGVKAFTNYLGSVEA
GKQYDPTELIVQYNGPKAKILIDQGTHDSFLYNQLHPQNFLKAASSVNYPVEFRYQNNYD
HLYFFVETFMGDHFKHHAQYLLR


>TTHERM_00295700(gene)
ATGGACGCATCTTTACTCTCTGAATTCCTTAAAACTGCTGGCCAAACCATCACTTGTAAG
GCTGCTGTAGCTTGGGAAGCTAACAAACCTTTAGATTACACTGACATTTAAGTTGCTCCT
CCTAAGAAAGGAGAAGTTCGTATTAAAGTTTTTGCAAATGCTCTTTGCCATACTGATATT
TACACCTTAGAAGGACACGATCCTGAAGGTCTTTTCCCAAGCATTCTTGGTCATGAAGGT
ACAGGTATTGTTGAAAGTATTGGTGAAGGAGTTACTTCTGTTAAGCCTGGTGATATTGTT
ATTCCTTGCTACACACCTGAATGCAGGGAATTCTCTTGTATTTATTGTAACAATGAAAAC
ACTAACCTTTGTCCTAAGATTAGAGCCTTCTAAGGTAAAAATTACTTTTATTTATTAATA
ATTAATATAGCTTAGCTTTCTATGAAGAACTACAACAATACTATGACTTTTAAGGAATTT
TATTAAAAGGATAAAGGCATAATTTATAAATTCTACTTACCATTAAATGATAAAGTGTAA
TATTATTAATTTTAATTAAAGGAAAGGGTTTGATGCCTGATGGTACAAGCAGATTTTCTA
AGGATGGTAAAACTATCTATCACTTTATGGGGTGTTCTAGTTTCTCTGAATACACAGTTG
TTGCTGAAATTTCTTGTGCTAAAGTTAGCGACAAGATTGATGTTAACCAAATGTGTCTTT
TGGGTTGTGGTATCAGCACTGGTTGGGGTGCTGCAATTAATACTTGCAAAGTAAGACCTG
GATCAACAGTTGTCGTATTTGGTCTTGGTGCAGTTGGTTTAGCAGTAGTTCAAGCTGCTA
AAATTAAAGGAGCAAGAAAAATTGTTGGTATTGATCTTAACAGTGAAAAATTCACTTTAG
CTAAAGATTTCGGTTGCACTGAATGCTGGAATCCTAAAGAGTTGGACGGTAAGACCATTA
AGGAACACCTTATTTCCTTAGAACCTTGGGGTTATGATTTCACATTTGATTGCACTGGTA
TCACTGCTGTTATGAGAGATGCTTTAGAAATTGCTCACAGAGGGTAATTAGTTTTTAAAA
GATGTTTTATATAGATATTCAAAATAGTTAATCAGTAACAAAAAAGATTCTTTGTGAATT
GGTTAGGAATAGGAAGAGAAAATTCACAATTTAATAAAAAAAATTTTATTGATAATTAAT
TTTTTAGGGTTTCCATCTAATTTTGAATATTTTTAATTACTATTGATCTTTGAATAAACA
AGCAAATGTAGGATTAAATTTATTAAATAAATTTTATGATTATTAATTATATAGATTTGG
TGAAAGTTGCGTTATTGGTGTTGCTGCTTCTGGTCATGAAATTTCTACTAGACCATTCTA
ATTAGTTACTGGTAGATAATGGAAAGGAACTGCCTTTGGTGGATGGAAAAGCAGAACTGA
AGTTCCCTAATTAGTTTAACAAGTATCTACTGGGGAATTGCCAATTCAAAAATACATTAC
TCATGAAATTAAGGGCTTACAAAATGTCAACTAAGCTATTGATGCTTTACACTCAGGAAA
ATGCTTGCGTGCAGTTGTTCATATCAACGAAAGACCTGATTTCAACAAAGAATAGGTATC
AAAGTTAGTCCCTCGTGTTTATTCTAATGCAAGAAGTCATAATGGATGGGTAAAGAGAGT
AAAGCATTATTCTGAATCTCTTTAATGCGAAATGCAATTTTCAATTTACATCCCTGATAA
GAAGTCTCGTAATGCTTAACTTCCCCCTGTTCTTTATTATCTTAGTGGACTTACTTGCAC
TGATGAAAACGCTTTGGTAAAATCTGGCTTCTAAAGATATGCCTCTGAACTCGGTATTGC
TGTTGTATTCCCTGACACCTCACCTCGTGTTGATATTGAAGGTGATAACGAAAGTTGGGA
CTTTGGTAAATCAGCTGGATTCTACTTAAATGCTACTTAAGAAAAATGGAGAAAGAACTA
CAATATGTTCACCTATATCTCTGAAGAATTACCAAAATTGATTGGAGAATTCTTCCCTGT
TGATGTAAGCAGAGCTGGTATTACTGGTCACTCTATGGGTGGTATGGGAGCTCTTAACAT
ATTCTTAAAGAACCCAGGTAAATATTTGAGTGTCTCTGCCTTTGCTCCTATTTGCAATCC
CACTTAGTGCCCTTGGGGAGTTAAGGCTTTCACTAACTATTTAGGCTCTGTAGAAGCTGG
TAAATAGTATGATCCAACTGAACTTATTGTTTAATATAATGGTCCCAAGGCTAAGATTTT
AATTGATCAAGGTACTCATGACTCATTCCTTTACAATTAACTTCATCCTTAAAATTTCTT
AAAGGCTGCATCTTCAGTTAATTACCCTGTTGAATTCAGATATCAAAATAACTATGATCA
CCTCTACTTCTTTGTAGAGACCTTCATGGGAGATCATTTCAAGCACCATGCTTAATATCT
TCTTAGATGA