Identifiers and Description

Gene Model Identifier

TTHERM_00678250

Standard Name

FRS3 (Phenylalanyl(F)-tRNA Synthetase 3)

Aliases

PreTt07589 | 102.m00109 | 3730.m00036

Description

Phenylalanyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01409 ) phenylalanyl-tRNA synthetase
  • ( TIGR00469 ) phenylalanyl-tRNA synthetase
  • ( PF00152 ) tRNA synthetases class II (D,
  • ( PF03147 ) Ferredoxin-fold anticodon binding domain
  • ( TIGR00468 ) phenylalanyl-tRNA synthetase, alpha subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.6%

TetraMine Data

TTHERM_00678250

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16392.19.997093137033517e-262phenylalanyl-tRNA synthetase (
419 aa)
OxytrichaContig16741.0.g681.9999788875029746e-125tRNA synthetases class II core
domain (F)
DictyBaseDDB_G02743711.9992982665753866e-121mpheS on chromosome: 2 positio
n 3786786 to 3788150
SGDYPR047W5.000729663236884e-95MSF1 Mitochondrial phenylalany
l-tRNA synthetase, active as a
monomer, unlike the cytoplasm
ic subunit which is active as
a dimer complexed to a beta su
bunit dimer; similar to the al
pha subunit of E. coli phenyla
lanyl-tRNA synthetase
WormBaseWBGene000133611.0002434920975502e-91locus:fars-2 status:Confirme
d UniProt:G5EEN1 protein_i
d:CBM41247.1
Stentor CoeruleusSteCoe_189701.5400882849875202e-51

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00678250(coding)
ATGATATTAGCAAGATAGTTAAATAATTTTATTAAGCTAAACAAGAGAAACTTAATTGCA
ACTACCTTATGTTTCTCTTATTAAAAACATTTTTCTAGTGTTACTGAGTAAATTCGTAAA
GAAATCGAAGAAAAAAAATCACCTTATGGCAATATTACTCCAAAGATTATAGAGTTAGCA
GGCCAAGAGTTGTATAAGCAACCTAACCATCCTTTAGGAATTATGCGTTATAAGATGGAA
GAATTTTTTACAAATGACAAATATAAGAAGGGCTTTTTGCATGAAAAGAAAAAGTTTCCT
TTCGTAATTGGAGATAGTTTCTCTCCTGTAATCAGTGTTCAGTAGAACTTCGAAGATCTT
CTCATCCCAAAAGATCATGTTTCTCGTAAAAGATCAGATACTTACTATATTTCTGAAAAT
TACATTATGAGACCATAAGCAACTGCAAATGAGCGTAACATGTTTGAACAAAAAGCTGAA
GCTTTCGTTATTTTTGCTGATTGCTTTAGAAGAGACGAGATAGATGCAACACATTACCCT
GTTTTCCATTAAATGGAAGTTGTTAGAGCATACACTCAAGATTACTTTGATACTAAGAAT
GAAGATATTAAAATATAAATGGTTATGAAGGATCTTTAAGAAACATATGAGAGTTTAGTC
AGAAATATTTTTGGTGAAGATGTTTAATATAGATGGATACCAGCTTATTTCCCATTCACG
GAACCTTCTTTGGAAATGGAAATATATTTCAATGGAGAATGGGTAGAAATGTTTGGATGT
GGTATCCTTCGTAAAGAAATTATGAAAAACTTCGGAAGACATGATGATGATATTGCATGG
GCATCAGGTGGTGGCTTAGAAAGATTCGCAATGCTTCTTTTTGGCATTCCTGATATTAGA
CTTTTCTGGAGTAAAGATTCTAGATTTTTGAATCAATTTAAGGCTGGACAAATTAACAAA
TTTTAGCCATTCAGTAAATATCCTGCTTGCTATAAGGATATATCTTTTTGGATAAAAGAT
ATGACAACTTTTGAAGAAAATGATATTTATGAAATTGTGAGAGAAATTGGAGGTGATCTT
ATTGAATAGGTAGAGTGTGTTGACACCTATGAGAATAAAAAGACTGGGAAAACTAGCAAA
TGCTTTAGAATAAATTACAGATCATTAGAAAGAACTCTTACAAATTAAGAAATTGACACC
TTATAATTCTCCATTAGAGATGAAATCAAAAATAAATTAGGTTATGAATTAAGATGA


>TTHERM_00678250(protein)
MILARQLNNFIKLNKRNLIATTLCFSYQKHFSSVTEQIRKEIEEKKSPYGNITPKIIELA
GQELYKQPNHPLGIMRYKMEEFFTNDKYKKGFLHEKKKFPFVIGDSFSPVISVQQNFEDL
LIPKDHVSRKRSDTYYISENYIMRPQATANERNMFEQKAEAFVIFADCFRRDEIDATHYP
VFHQMEVVRAYTQDYFDTKNEDIKIQMVMKDLQETYESLVRNIFGEDVQYRWIPAYFPFT
EPSLEMEIYFNGEWVEMFGCGILRKEIMKNFGRHDDDIAWASGGGLERFAMLLFGIPDIR
LFWSKDSRFLNQFKAGQINKFQPFSKYPACYKDISFWIKDMTTFEENDIYEIVREIGGDL
IEQVECVDTYENKKTGKTSKCFRINYRSLERTLTNQEIDTLQFSIRDEIKNKLGYELR


>TTHERM_00678250(gene)
ATGATATTAGCAAGATAGTTAAATAATTTTATTAAGCTAAACAAGAGAAACTTAATTGCA
ACTACCTTATGTTTCTCTTATTAAAAACATTTTTCTAGTGTTACTGAGTAAATTCGTAAA
GAAATCGAAGAAAAAAAATCACCTTATGGCAATATTACTCCAAAGATTATAGAGTTAGCA
GGCCAAGAGTTGTATAAGCAACCTAACCATCCTTTAGGAATTATGCGTTATAAGATGGAA
GAATTTTTTACAAATGACAAATATAAGAAGGGCTTTTTGCATGAAAAGAAAAAGTTTCCT
TTCGTAATTGGAGATAGTTTCTCTCCTGTAATCAGTGTTCAGTAGAACTTCGAAGATCTT
CTCATCCCAAAAGATCATGTTTCTCGTAAAAGATCAGATACTTACTATATTTCTGAAAAT
TACATTATGAGACCATAAGCAACTGCAAATGAGCGTAACATGTTTGAACAAAAAGCTGAA
GCTTTCGTTATTTTTGGTAATTACTTTATTTTGTTATTTAAGAATTATAATAGAAATTGT
CATTAGATTTATTTAAAATGCAAGATTATCTCTATCAAATTCATATTATAAAAGAAATAA
TATTCAAGATGTTATGTATTTTAAATTAAAATTTTTTTTTATAAAATATAAGCTGATTGC
TTTAGAAGAGACGAGATAGATGCAACACATTACCCTGTTTTCCATTAAGTAATATATAAC
TAATAAATCGAAAAAGAGAAAATAAAATAAACTTATAGAATCAAGATTGAACTTTTTCTT
AATAAGAATTAATTAAATATTTAAATGAAAATAAATTCAACAAAAAATATTCTATTCAGC
AATAAATTTAATCAATTTAATGTAATTAACTAATTTTGTATCATATTAAAGATGGAAGTT
GTTAGAGCATACACTCAAGATTACTTTGATACTAAGAATGAAGATATTAAAATATAAATG
GTTATGAAGGATCTTTAAGAAACATATGAGAGTTTAGTCAGAAATATTTTTGGTGAAGAT
GTTTAATATAGATGGATACCAGCTTATTTCCCATTCACGGAACCTTCTTTGGAAATGGAA
ATATATTTCAATGGAGAATGGGTAGAAATGTTTGGATGTGGTATCCTTCGTAAAGAAATT
ATGAAAAACTTCGGAAGACATGATGATGATATTGCATGGGCATCAGGTGGTGGCTTAGAA
AGATTCGCAATGCTTCTTTTTGGCATTCCTGATATTAGGTTATTTATTAATTTAAAATTA
TACTAAAATAAGTTTATTTGCCTACTAACAAAAGTTTAATCTTTTGGATGGATAAATCTA
CTTTTAGAATAATAAAAAGTTAAAAATATCGTTTGATTTAATTTAATTATTTTTATTTCT
ATAGACTTTTCTGGAGTAAAGATTCTAGATTTTTGAATCAATTTAAGGCTGGACAAATTA
ACAAATTTTAGCCATTCAGTAAATATCCTGCTTGCTATAAGGATATATCTTTTTGGATAA
AAGATATGACAACTTTTGAAGAAAATGATATTTATGAAATTGTGAGAGAAATTGGAGGTG
ATCTTATTGAATAGGTAGAGTGTGTTGACACCTATGAGAATAAAAAGACTGGGAAAACTA
GCAAATGCTTTAGAATAAATTACAGATCATTAGAAAGAACTCTTACAAATTAAGAAGTAA
AATTTTTATTTCGACCCATTTTAATTATCAATTAAATATCTTTTGAATATTTACTTGAAT
ATTTAATTAATGTCGTTTTTAGTTTTTAGGTTAAGATTGAATAAATAAAAAAATTTTTAT
TTATTTTTTTTATGCTAATAAAAAATAAGAATATTCTTTCGGCATAATAAATTTAATTGT
TAGTATAATAACCTAAATTAATTAATTAAGATTATTAAGAAGAACTTTCACAAACTCTGT
TCTAGCTTAACTTGTCGAATAATTTCTTCATTAACTTTTTTTTCTTAAAAATAGATTGAC
ACCTTATAATTCTCCATTAGAGATGAAATCAAAAATAAATTAGGTTATGAATTAAGATGA