Identifiers and Description

Gene Model Identifier

TTHERM_00218410

Standard Name

FRS2 (phenylalanyl-tRNA synthetase 2)

Aliases

PreTt22268 | 18.m00294 | 3701.m00054

Description

phenylalanyl-tRNA synthetase, beta subunit family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF03483 ) B3/4 domain
  • ( PF03484 ) phenylalanine-tRNA synthetase, B5 domain
  • ( TIGR00471 ) phenylalanyl-tRNA synthetase, beta subunit
  • ( TIGR00472 ) phenylalanyl-tRNA synthetase, beta subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00218410

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06614.19.997093137033517e-262phenylalanyl-tRNA synthetase,
beta subunit protein (591 aa)
WormBaseWBGene000014986.002322951831963e-178locus:fars-3 Phenylalanine--
tRNA ligase beta subunit sta
tus:Confirmed UniProt:Q19713
protein_id:CAA90360.1
DictyBaseDDB_G02773032.0002969069156684e-168phesB on chromosome: 2 positio
n 7623909 to 7626465
OxytrichaContig14504.0.g561.9994249217050915e-157B3/4 domain
SGDYLR060W9.995193436412938e-154FRS1 Beta subunit of cytoplasm
ic phenylalanyl-tRNA synthetas
e, forms a tetramer with Frs2p
to generate active enzyme; ab
le to hydrolyze mis-aminoacyla
ted tRNA-Phe, which could cont
ribute to translational qualit
y control
Stentor CoeruleusSteCoe_144296.714184288211594e-79

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00218410(coding)
ATGCCTATTGTCTCTGTTAACATTAAAAATTTCTTCAAAAAGTTAGGAAAGGAACTCAAA
TTCCACGAATTGGAAGAATTATGCTTCGAATATGGTATCGAAGTAGAAGAAAAGGAAGTC
TCCAAGAAAAATAAGAAGTCAGGCAAAGAAGAAAAAGTTAAAGAATATGCTTTTGAAGTT
GGTGCTAACAGACCTGATTTACTCTCTGTAGAAACTCTTACTTAAGCTTTGGGAGTCTTT
ATTGGTACTCGCCAACCCCCTCAATATACAGTAAAGCCTGTTGAACAAAGATAAAAGATT
ATTGTTAAGAAGGATTGCAAGCGTATTAGACCTTTTGTTGTTGGTGCTGTTTTGAGAAAT
GTTACCTTCACTCAAGAATCCTATGATTCTTTCATTGACTTCTAAGATAAGTTACATCAC
AATCTTTGTCGTAGAAGAAGATTAGTCGCTATTGGTACTCATGATTTAGATACCATATAA
GGTCCTTTTACTTATGATGCTAGAAACCCTGCTGACATCAAGTTTGTACCTCTCGATAAA
ACCGAAAGCATGGATGGAAACAGACTTATGGAATTTTACGAAAAAGACTCTCACTTAAAA
GATTTCTTACCCATTATCAGAAATTCTCCTGTTTATCCTGTAATTCTTGACTCAAATAAT
GTTGTATGCTCTCTTCCTCCCATCATTAATGGTGACCACTCTAAAATTAAACTTACTACT
AAAAACGTTTTTATTGAATCAACTGCTACTGACTATACTAGAGCTTTGATTGCCTTAAAC
TGTTTAGTTGCTGCCTTCTCTGAATATTGTGCTGAACCCTACACCGTCGAAGAAGTTGAA
ATTCATTATGAAGAAGAAAATAGAACAGATATTACTCCCTAATTTACTATTAATAAATTT
TAAACTAAAATTTCTCACTTAAACAGCGTTGGTACCATCAATGTTACTGCAGAATAAGCT
TGCAAATTATTAGAAAGAATGAGTCTTACTGCAAAAGTTCTTAATAATGATGAAATCGAA
GTAGCTGTCCCAATCACCAGAGGAGATATTCTTTAAGAGTGTGATATTATTGAAGACGTT
TGCATTGCATACGGTTTCAAAAACATCAAGGCTGTTTTACCTAAAACTCCTACTGTTGGT
AAATAATTATTACTCAACAAGATGAGTGATTTGATTCGTGAAGAAATCGCTGCAGCTGGT
TATAAGGAAGGTCTTAATTTCGTTTTAGTTTCAAGAGATGATTTAACCAAAAAGCTTAAA
AAGGAAAATGATGAATAAATGATTATTATTGACAACCCCAAAACTGAAGAATTCAGCGTT
GGTAGAACTACACTTCTTCCTGGTTGCCTTAAATGGTTATCATCAAATAAAAAGAATAAG
ATCCCTATCAGTATGTTTGAAGTTGGTGATGTTATTTTGAAGGATGAAACTAGAGAAACT
AATACCAGAAACGAAAGAAGATTATGTGCTATCTACACTAATCACAACTCTGAATTAGAA
GTTGTTCATGGTTTACTTGATTATATTATGTTAAAGCTTATGGTTAACCTTGATTCTACA
GGAACTTGTAAGGCAGAAAGAAGATACAGACTTGTTCCTTCTGATGAACCTACATATTTC
TTAGATAGATAAGCTCATGTCTACTACAATGATAAGAAAATCGGAAATTTGGGTATCTTA
CATCCAGATGTTGTTAAAAATTTCGAATGGAAATATCCCGTTTCTGTTTTGGAATTAAAT
TTAGAACCTCTTATTAACGAATTCCACTAATGA


>TTHERM_00218410(protein)
MPIVSVNIKNFFKKLGKELKFHELEELCFEYGIEVEEKEVSKKNKKSGKEEKVKEYAFEV
GANRPDLLSVETLTQALGVFIGTRQPPQYTVKPVEQRQKIIVKKDCKRIRPFVVGAVLRN
VTFTQESYDSFIDFQDKLHHNLCRRRRLVAIGTHDLDTIQGPFTYDARNPADIKFVPLDK
TESMDGNRLMEFYEKDSHLKDFLPIIRNSPVYPVILDSNNVVCSLPPIINGDHSKIKLTT
KNVFIESTATDYTRALIALNCLVAAFSEYCAEPYTVEEVEIHYEEENRTDITPQFTINKF
QTKISHLNSVGTINVTAEQACKLLERMSLTAKVLNNDEIEVAVPITRGDILQECDIIEDV
CIAYGFKNIKAVLPKTPTVGKQLLLNKMSDLIREEIAAAGYKEGLNFVLVSRDDLTKKLK
KENDEQMIIIDNPKTEEFSVGRTTLLPGCLKWLSSNKKNKIPISMFEVGDVILKDETRET
NTRNERRLCAIYTNHNSELEVVHGLLDYIMLKLMVNLDSTGTCKAERRYRLVPSDEPTYF
LDRQAHVYYNDKKIGNLGILHPDVVKNFEWKYPVSVLELNLEPLINEFHQ


>TTHERM_00218410(gene)
ATGCCTATTGTCTCTGTTAACATTAAAAATTTCTTCAAAAAGTTAGGAAAGGAACTCAGT
AAAAATATTCATTACATTCTCATATAGAATAAACAATAAAATAATTATTTTATTCAAATC
TAAATTAAAATAAATTAATATGATCAGAAACATTCAAATATTTGATAATATGGATCATAA
ATGAAACAACATATTCAACAAGCTTCAATTTAACTTCTTTTCTCAAATAATAACAATTTG
AATACTAAAATCTTATCACTTTATTTAATTATGAACAGAATTCCACGAATTGGAAGAATT
ATGCTTCGAATATGGTATCGAAGTAGAAGAAAAGGAAGTCTCCAAGAAAAATAAGAAGTC
AGGCAAAGAAGAAAAAGTTAAAGAATATGCTTTTGAAGTTGGTGCTAACAGACCTGATTT
ACTCTCTGTAGAAACTCTTACTTAAGCTTTGGGAGTCTTTATTGGTACTCGCCAACCCCC
TCAATATACAGTAAAGCCTGTTGAACAAAGATAAAAGATTATTGTTAAGAAGGATGTAAT
ACATTAATTTAAAAAAAATAAATAGGAAACATTTAAATAATCCAAATAGTTTTATTCAGA
AAGCAAAAAATAAAAAAAAAGTTGATAGAAATGATATTAATTTTTTGATTTTATTCATCA
GTTAAATTGTTTTTTATTCTACCAAGCATTTGCTTTTCTGAGCTCTCTATATTTTAGCAT
TATTCTAAATTTTTATAATTTGAAAAAAGTGCAAGCGTATTAGACCTTTTGTTGTTGGTG
CTGTTTTGAGAAATGTTACCTTCACTCAAGAATCCTATGATTCTTTCATTGACTTCTAAG
ATAAGTTACATCACAATCTTTGTCGTAGAAGAAGATTAGTCGCTATTGGTACTCATGATT
TAGATACCATATAAGGTCCTTTTACTTATGATGCTAGAAACCCTGCTGACATCAAGTTTG
TACCTCTCGATAAAACCGAAAGCATGGATGGAAACAGACTTATGGAATTTTACGAAGTAA
ATTTTAAATATGTTTTAAATGAAATTTATATAATAATTTATTAATATTTGTAGAAAGACT
CTCACTTAAAAGATTTCTTACCCATTATCAGAAATTCTCCTGTTTATCCTGTAATTCTTG
ACTCAAATAATGTTGTATGCTCTCTTCCTCCCATCATTAATGGTGACCACTCTAAAATTA
AACTTACTACTAAAAACGTTTTTATTGAATCAACTGCTGTAATAAATATTTAAAAATTTT
ATTTAATTAAATTAAAATATTATTTATATTTTAAAGACTGACTATACTAGAGCTTTGATT
GCCTTAAACTGTTTAGTTGCTGCCTTCTCTGAATATTGTGCTGAACCCTACACCGTCGAA
GAAGTTGAAATTCATTATGAAGAAGAAAATAGAACAGATATTACTCCCTAATTTACTATT
AATAAATTTTAAACTAAAATTTCTCACTTAAACAGCGTTGGTACCATCAATGTTACTGCA
GAATAAGCTTGCAAATTATTAGAAAGAATGAGTCTTACTGCAAAAGTTCTTAATAATGAT
GAAATCGAAGTAGCTGTCCCAATCACCAGAGGAGGTAATAATTACAAAAAGACAAAATAT
GAAATAAACTATATTTTTAAAATTAATGTAACAGATATTCTTTAAGAGTGTGATATTATT
GAAGACGTTTGCATTGCATACGGTTTCAAAAACATCAAGGCTGTTTTACCTAAAACTCCT
ACTGTTGGTAAATAATTATTACTCAACAAGATGAGTGATTTGATTCGTGAAGAAATCGCT
GCAGCTGGTTATAAGGAAGGTCTTAATTTCGTTTTAGTTTCAAGAGATGATTTAACCAAA
AAGCTTAAAAAGGAAAATGATGAATAAATGATTATTATTGACAACCCCAAAACTGAAGAA
TTCAGCGTTGGTAGAACTACACTTCTTCCTGGTTGCCTTAAATGGTTATCATCAAATAAA
AAGAATAAGGTAATTTACTATAATTGACTACAAATAGCATAACATTTGAATTTAAAATAG
ATCCCTATCAGTATGTTTGAAGTTGGTGATGTTATTTTGAAGGATGAAACTAGAGAAACT
AATACCAGAAACGAAAGAAGATTATGTGCTATCTACACTAATCACAACTCTGAATTAGAA
GTTGTTCATGGTTTACTTGATTATATTATGTTAAAGCTTATGGTTAACCTTGATTCTACA
GGAACTTGTAAGGCAGAAAGAAGATACAGACTTGTTCCTTCTGATGGTAAGATTATTTAA
AAATAGATATTATTTAATTAACCATTTATTATTTTAGAACCTACATATTTCTTAGATAGA
TAAGCTCATGTCTACTACAATGATAAGAAAATCGGAGTAAAATTTATAATTTTCTAAAAA
TATAAATGTTAAAAAATATTTGTTTTAAAAAAAGAATTTGGGTATCTTACATCCAGATGT
TGTTAAAAATTTCGAATGGAAATATCCCGTTTCTGTTTTGGAATTAAATTTAGAACCTCT
TATTAACGAATTCCACTAATGA