Identifiers and Description

Gene Model Identifier

TTHERM_00133690

Standard Name

FRS1 (phenylalanyl-tRNA synthetase 1)

Aliases

PreTt24292 | 10.m00341 | 3698.m00063

Description

phenylalanyl-tRNA synthetase, alpha subunit family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01409 ) phenylalanyl-tRNA synthetase
  • ( PF07377 ) Protein of unknown function (DUF1493)
  • ( TIGR00470 ) O-phosphoseryl-tRNA(Cys) synthetase
  • ( PF00152 ) tRNA synthetases class II (D,
  • ( TIGR00468 ) phenylalanyl-tRNA synthetase, alpha subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00133690

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05732.19.997093137033517e-262phenylalanyl-tRNA synthetase,
alpha subunit protein (513 aa)
OxytrichaContig1385.1.g553.000071119766155e-172tRNA synthetases class II core
domain (F)
WormBaseWBGene000014979.995404496431436e-166locus:fars-1 status:Confirme
d UniProt:Q86B36 protein_i
d:CCD67615.1
SGDYFL022C4.001878793042739e-150FRS2 Alpha subunit of cytoplas
mic phenylalanyl-tRNA syntheta
se, forms a tetramer with Frs1
p to form active enzyme; evolu
tionarily distant from mitocho
ndrial phenylalanyl-tRNA synth
etase based on protein sequenc
e, but substrate binding is si
milar
DictyBaseDDB_G02871415.997984985848154e-146phesA on chromosome: 4 positio
n 5374001 to 5375464
Stentor CoeruleusSteCoe_308542.7086952666810816e-76

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00133690(coding)
ATGGAAAAGAATTACACTTAATTAATTTTAACTGAATTAGAGTAAAATGGTGAAATCCCT
GATACTCTATTATTGGCAAAGAAATTTGAAATTGAACATCAAGAATTAGTTGGTTATTTA
AATTCTTTGCTTTTAGAGAACTACATTACTTAAGAAGTTAAGGAAATTTAAAGATGGGTA
CTTTTATAAGAAGGTTTAGATAATGTTACTAATGGCACTCCCGAATTCAGAGTGTTCTAG
GGTATCCCTGCTGAAGGTATTTCAAAGAATGATTTAGAAGCTAAATTTGATCCCAATGTT
TTCAAGTTCGGTTTATAAAATGGTATGAAAAAGAAGTGGTTCAAGATTAAGGACGGTCTT
ATTCAAAAAGAAGTAGCTGAAGTAGTCGATGAAGATGCTGTTCTTTTAAAAAGAATTGAA
TCTAACAGCAATTTGGAAGATATTAAAAAGGACGTTTTCGATAATCTTAAGAAGAGAAAG
ATTATTTCTTAGGAAGTTATCAAATATTTCAAAATTAATAAAGGTGCTGAATTCAAGCCC
ATTTATGTTGAACTTGAATCTGATTTAACTTATGATATGGTTAAGAACTACGATGATTTT
GTCAAGAATGAAGATGGAACAATTAAATCAAATACTGAACTCGCTAAATAATTCAAAAAA
TATAATTGGAATTCTGTTGGTAAAGATATAAAAACTGGTAACTTGCATCCTTTGATGAAA
GTCAGAAAATAATTCAGAGAAGTTCTTATTGAAATGGGATTCGAAGAAATGGCTACCAAC
CAATATGTTGAAAGTGGTTTCTGGAACTTCGATGCCCTTTTCTAACCTTAATAACATCCT
GCCAGAGATGCTCACGATACTTTCTTCATTAGAGAACCTGCTCACAGCAAGAATTTAGAT
CCTGAATACTGGGAAAGAGTTAAGAAAACTCACGAAGTAGGTGGTTATGGATCTATTGGT
TATCGTTATGATTGGAGTTATGATGAAGCCAAAAAGAACATCTTCCGTACTCACACAACT
GCTGTTTCATCTAAAATGTTAAGACAAATTGCCATCGAATATGCTAAGGACGGCGTTTTC
AAACCTAGAAAATTCTTCTCTATTGATAGAGTCTTCAGAAATGAAAGCTTAGATGCTACT
CACTTGGCTGAATTCCATTAAATTGAAGGTGTTATCGCTGATAAGAATGTTGGTCTTGGT
GAACTACTTGGAGTTATTACTGAATTCTTTGCTAAAATAGGTATTACTGGCTTGAAGTTT
AAGCCCACATATAACCCATACACAGAACCATCCTTGGAAATTCATGGTTTCCATCCTGGT
TTGAATAAAGTCATTGAATTAGGTAACAGTGGTGTTTTCAGACCTGAAATGTTACGTCCC
ATGGGATTACCAGAAGATATTTAAGTTTTAGGTTGGGGTCTTGGTTTAGAAAGACCTACA
ATGATATAATATAAATTCAAAAATATCAGAGATCTTCTTGGTTACGGTGTAGATATGAAA
CTCCTTAAGGAAAATCCTATTTGCTGTTTCAAGAATTGA


>TTHERM_00133690(protein)
MEKNYTQLILTELEQNGEIPDTLLLAKKFEIEHQELVGYLNSLLLENYITQEVKEIQRWV
LLQEGLDNVTNGTPEFRVFQGIPAEGISKNDLEAKFDPNVFKFGLQNGMKKKWFKIKDGL
IQKEVAEVVDEDAVLLKRIESNSNLEDIKKDVFDNLKKRKIISQEVIKYFKINKGAEFKP
IYVELESDLTYDMVKNYDDFVKNEDGTIKSNTELAKQFKKYNWNSVGKDIKTGNLHPLMK
VRKQFREVLIEMGFEEMATNQYVESGFWNFDALFQPQQHPARDAHDTFFIREPAHSKNLD
PEYWERVKKTHEVGGYGSIGYRYDWSYDEAKKNIFRTHTTAVSSKMLRQIAIEYAKDGVF
KPRKFFSIDRVFRNESLDATHLAEFHQIEGVIADKNVGLGELLGVITEFFAKIGITGLKF
KPTYNPYTEPSLEIHGFHPGLNKVIELGNSGVFRPEMLRPMGLPEDIQVLGWGLGLERPT
MIQYKFKNIRDLLGYGVDMKLLKENPICCFKN


>TTHERM_00133690(gene)
ATGGAAAAGAATTACACTTAATTAATTTTAACTGAATTAGAGTAAAATGGTGAAATCCCT
GATACTCTATTATTGGCAAAGAAATTTGAAATTGAACATCAAGAATTAGTTGGTTATTTA
AATTCTTTGCTTTTAGAGAACTACATTACTTAAGAAGTTAAGGAAATTTAAAGATGGGTA
CTTTTATAAGAAGGTTTAGATAATGTTACTAATGGCACTCCCGAATTCAGAGTGTTCTAG
GGTATCCCTGCTGAAGGTAAATTTATTTTATCTTTATTTGAATTCATACCTTAAAACAGT
TTACAGCAATTTCTAAAAAATAGTTTTACAGCTTAGATTTATTATAAAATTTGGCACATT
TCAAAAAATATTTTTTAAATTTGTATGAATTTAAAGCTCAATAAGCAAACAAATAAATGA
TTTATTTTAACTAATGATAAATTTAGGTATTTCAAAGAATGATTTAGAAGCTAAATTTGA
TCCCAATGTTTTCAAGTTCGGTTTATAAAATGGTATGAAAAAGAAGTGGTTCAAGATTAA
GGACGGTCTTATTCAAAAAGAAGTAGCTGAAGTAGTCGATGAAGATGCTGTTCTTTTAAA
AAGAATTGAATCTAACAGCAATTTGGAAGATATTAAAAAGGACGTTTTCGATAATCTTAA
GAAGAGAAAGATTATTTCTTAGGAAGTTATCAAATATTTCAAAATTAATAAAGGTGCTGA
ATTCAAGCCCATTTATGTTGAACTTGAATCTGATTTAACTTATGATATGGTTAAGAACTA
CGATGATTTTGTCAAGAATGAAGATGGAACAATTAAATCAAATACTGAACTCGCTAAATA
ATTCAAAAAATATAATTGGAATTCTGTTGGTAAAGATATGTAAATAACCTATTTGAATAT
TTTTATGTTAATGCTGCTTAAGATATTATATTTTTATTTTTAAATAAACGACTTTTATAC
TAAAAAATACGATTTATAAAAATAGAAAAACTGGTAACTTGCATCCTTTGATGAAAGTCA
GAAAATAATTCAGAGAAGTTCTTATTGAAATGGGATTCGAAGAAATGGCTACCAACCAAT
ATGTTGAAAGTGGTTTCTGGAACTTCGATGCCCTTTTCTAACCTTAATAACATCCTGCCA
GAGATGCTCACGATACTTTCTTCATTAGAGAACCTGCTCACAGCAAGAATTTAGATCCTG
AATACTGGGAAAGAGTTAAGAAAACTCACGAAGTAGGTGGTTATGGATCTATTGGTTATC
GTTATGATTGGAGTTATGATGAAGCCAAAAAGAACATCTTCCGTACTCACACAACTGCTG
TAATTTACTGAATTTAACCTTTAAAAATAATTAATTAATAAATAGCTAGAAAAAATAAAT
AATTAGCATAAAAAATATTTAGAATATTATCAAAAAAAATTAGCTAAGCAAATATTATTG
AAATAATAATTAGGTTTCATCTAAAATGTTAAGACAAATTGCCATCGAATATGCTAAGGA
CGGCGTTTTCAAACCTAGAAAATTCTTCTCTATTGATAGAGTCTTCAGAAATGAAAGCTT
AGATGCTACTCACTTGGCTGAATTCCATTAAATTGAAGGTGTTATCGCTGATAAGAATGT
TGGTCTTGGTGAACTACTTGGAGTTATTACTGAATTCTTTGCTAAAATAGGTAATATTAT
TTTAGCTTTTATAAATAAATATTCTATTTTTTAAATTAAATCAATAAATTAAAGGTATTA
CTGGCTTGAAGTTTAAGCCCACATATAACCCATACACAGAACCATCCTTGGAAATTCATG
GTTTCCATCCTGGTTTGAATAAAGTCATTGAATTAGGTAACAGTGGTGTTTTCAGACCTG
AAATGTTACGTCCCATGGGATTACCAGAAGATATTTAAGTTTTAGGTTGGGGTCTTGGTT
TAGAAAGACCTACAATGATATAATATAAATTCAAAAATATCAGAGATCTTCTTGGTTACG
GTGTAGATATGAAACTCCTTAAGGAAAATCCTATTTGCTGTTTCAAGAATTGA