Identifiers and Description

Gene Model Identifier

TTHERM_00689980

Standard Name

FOP2 (FOP amine-terminal 2)

Aliases

PreTt23194 | 105.m00161 | 3737.m00073

Description

Fop amine-terminal dimerization domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.8%

TetraMine Data

TTHERM_00689980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16614.12.0004683842646898e-122hypothetical protein (292 aa)
OxytrichaContig624.1.g1150.0000000000009003435339752751FOP N terminal dimerisation do
main

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00689980(coding)
ATGAGTGAAAAAGAAGAAAAATAGCTGTCAGATTTAATAATGTAAACTTTAGAAGCAAGC
GGCTCATTAGCAGCAGTAAAAGCTATGATAAGATAGTAAGTTTTTAATGTAGTTAACAAT
GAACCACCTTCATCATAAATTAATATAAATGATAAAGATAAAAAGCAGACAAAATATTAA
CCATCATAATAAAATTTAAAGTAGAAAGAATCTGCTCTTCATATGAGTAATAAAACTCTT
TAAAGTGCTTTAAAAAATGAGGAGGAAAAATTAACTTTAGTGCTAGTAAAGGAACTATTA
AAGTATTATTAGATGGATTATACTTTGAATATATTTAGCAGTGAAGCAAATTTATAAGAA
GATCCAGATAGAAGTAGTTTAGCTTAATAAACAAAAACAAACTAATCTGAAAAAAAGCCT
ATCTTAGTTTAAATAGTACAAAATTGTCTAAGTGGGAAAAATGTAAATACAAGCTCTTAT
AAAAATGAAAGTAGCACCTCTGCAGCTGCACCTAAAGAGGCTTAAAAAACTCAGTTAAAG
TAAAAAGAAGAACCAATTAAATAAAACAAAGAAATTAATTAAAAGAAAGAAGCAATTACA
AATAAATATTCAGTTACTAAATATGATAATATTAAAAATATAAGTAACAAATACGATAAA
AATAATGAGATTGAAGAATCTATGGGTGGTTTTGAAGATATATCTGAAGAAGAAGACTAT
AGTAAACCTCCATCAAAACCAAAATAGGTCTAAGGAAAAAGCTCTGCCTAGAATAATGAG
AGGAAAAATCCAATGTTTAGTAGTATGGAAGATACGTATGGTGCTTCGATGAGTTATGGA
CATGATTAGTCTGTTGACTCTATGAAACTTGAAGAAGAATATGATTACAACGAAAATATA
GCTTGA


>TTHERM_00689980(protein)
MSEKEEKQLSDLIMQTLEASGSLAAVKAMIRQQVFNVVNNEPPSSQININDKDKKQTKYQ
PSQQNLKQKESALHMSNKTLQSALKNEEEKLTLVLVKELLKYYQMDYTLNIFSSEANLQE
DPDRSSLAQQTKTNQSEKKPILVQIVQNCLSGKNVNTSSYKNESSTSAAAPKEAQKTQLK
QKEEPIKQNKEINQKKEAITNKYSVTKYDNIKNISNKYDKNNEIEESMGGFEDISEEEDY
SKPPSKPKQVQGKSSAQNNERKNPMFSSMEDTYGASMSYGHDQSVDSMKLEEEYDYNENI
A


>TTHERM_00689980(gene)
ATGAGTGAAAAAGAAGAAAAATAGCTGTCAGATTTAATAATGTAAACTTTAGAAGCAAGC
GGCTCATTAGCAGCAGTAAAAGCTATGATAAGATAGTAAGTTTTTAATGTAGTTAACAAT
GAACCACCTTCATCATAAATTAATATAAATGATAAAGATAAAAAGCAGACAAAATATTAA
CCATCATAATAAAATTTAAAGTAGAAAGAATCTGCTCTTCATATGAGTAATAAAACTCTT
TAAAGTGCTTTAAAAAATGAGGAGGAAAAATTAACTTTAGTGCTAGTAAAGGAACTATTA
AAGTATTATTAGATGGATTATACTTTGAATATATTTAGCAGTGAAGCAAATTTATAAGAA
GATCCAGATAGAAGTAGTTTAGCTTAATAAACAAAAACAAACTAATCTGAAAAAAAGCCT
ATCTTAGTTTAAATAGTACAAAATTGTCTAAGTGGGAAAAATGTAAATACAAGCTCTTAT
AAAAATGAAAGTAGCACCTCTGCAGCTGCACCTAAAGAGGCTTAAAAAACTCAGTTAAAG
TAAAAAGAAGAACCAATTAAATAAAACAAAGAAATTAATTAAAAGAAAGAAGCAATTACA
AATAAATATTCAGTTACTAAATATGATAATATTAAAAATATAAGTAACAAATACGATAAA
AATAATGAGATTGAAGAATCTATGGGTGGTTTTGAAGATATATCTGAAGAAGAAGACTAT
AGTAAACCTCCATCAAAACCAAAATAGGTCTAAGGAAAAAGCTCTGCCTAGAATAATGAG
AGGAAAAATCCAATGTTTAGTAGTATGGAAGATACGTATGGTGCTTCGATGAGTTATGGA
CATGATTAGTCTGTTGACTCTATGAAACTTGAAGAAGAATATGATTACAACGAAAATATA
GCTTGA