Identifiers and Description

Gene Model Identifier

TTHERM_00537420

Standard Name

FOP1 (FOP amine-terminal 1)

Aliases

PreTt03228 | 69.m00270 | 3718.m00131

Description

Fop amine-terminal dimerization domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00537420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11103.19.997093137033517e-262hypothetical protein (388 aa)
OxytrichaContig624.1.g1155.000574419929632e-30FOP N terminal dimerisation do
main

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00537420(coding)
ATGTAGGAACTTAATGAATTAAAAAATCTTGTGATTTAATCATTGGAAGCTAACGGATCA
TTGAGCAATATTAGAGCTTAAATTAGAGCATCTGTATTTAAAGTTATTGACCAATAAGAT
AACAATTAAGTTTAAAATAAAAAACCCAGTCCTTTCGCTTGGGAAAACCCAAAATGTGCA
AAGTTATTTGAAAGTGAAAGTGGTGTTCTTGCTCTTTAATTGATTAAAGAATTTCTTTAA
TTTTATAACATGGATTACTCTAATAGCGTATTCTCTTCTGAAAGTAATTTAAGGGAAGAA
GTAAAAAGAGACAAAATAAATGAAAAATTATCCTTAAATAAACCAGATGCTTAAAAACCA
TTACTACTCTAATTACTAGAAGAATTTAAATCTGGACGTAGTAGCATGAACTCAAGTGGA
ACTCAATCAGCTGCTCCTAATCCTAATACAGGAGCTTAAAAATAAGAATAAAAAAGTTAA
CAAGAGGGACAAGTCTAAAAAGGTTCTACATAAAGAAGTTAACAAGAGTAATAATAGTAA
CCTCAATAATAATAATAGCAGCTGTAATAATAATAATAACAATAGTAACAATAGCGCTAA
TAACAAGCTAACTACCAAGACTTATTAGGCGATGATGAATTTGAATAATCTCTAGATTCA
TAGAGCGATAATAAGAATTTTTAATCATAGAATAAGCCTATGTCATCTCCTTAAAATGAT
GATAAGAGCGCTTAAAGCTTAGAAAGTACAAGCGAAAAGAAAGCTCTTCAAGAAGCCTAG
TAATTCATTTAAAAAAGTTAAAACTAAATGCGTACTGGACAAATAGGTTCTTTACCAGTT
GGGTAATAATAGTAACAATAATAATAGCAATAACAACAATAATAGTAAAGTGCTGTATAA
TAAAATAAATTTAACGCCAACGTGAAATAATATGAACAAGATTAGTTTGATTAATATGAT
GATGAGATTGAAGGTGTGGAAGAGCAACTTAATGATTACTAAGAAGATATTGATGTAGAT
GACGATATTCTAAACTCAAAAGGAAAGAATGCAGGAGCAAGTAATTAAAGCCATTTTGAA
GAGTCAGAAGACTATATAGGGTAGTCATCAAAGGGTCATGATATTTCAGTTGATTCATAT
GCATTAGAAAACTTTGATTATCTCGAAGATGTTGAAGATTAATGA


>TTHERM_00537420(protein)
MQELNELKNLVIQSLEANGSLSNIRAQIRASVFKVIDQQDNNQVQNKKPSPFAWENPKCA
KLFESESGVLALQLIKEFLQFYNMDYSNSVFSSESNLREEVKRDKINEKLSLNKPDAQKP
LLLQLLEEFKSGRSSMNSSGTQSAAPNPNTGAQKQEQKSQQEGQVQKGSTQRSQQEQQQQ
PQQQQQQLQQQQQQQQQQRQQQANYQDLLGDDEFEQSLDSQSDNKNFQSQNKPMSSPQND
DKSAQSLESTSEKKALQEAQQFIQKSQNQMRTGQIGSLPVGQQQQQQQQQQQQQQQSAVQ
QNKFNANVKQYEQDQFDQYDDEIEGVEEQLNDYQEDIDVDDDILNSKGKNAGASNQSHFE
ESEDYIGQSSKGHDISVDSYALENFDYLEDVEDQ


>TTHERM_00537420(gene)
TAAATTTAAAAATATAAGAAGAAATAAAATAAAATAACATTCATTGTCAAGATTTACAAA
AAATTTTAACGAAAAAAAAATTCAAAAGAAAATAACTTTAAAGGTAATTCATATCACAAA
AAAGTAATTGATCAATCTAATAGTTTTAAGCATATTGAACAGACAAAATAAATGTAGGAA
CTTAATGAATTAAAAAATCTTGTGATTTAATCATTGGAAGCTAACGGATCATTGAGCAAT
ATTAGAGCTTAAATTAGAGCATCTGTATTTAAAGTTATTGACCAATAAGATAACAATTAA
GTTTAAAATAAAAAACCCAGTCCTTTCGCTTGGGAAAACCCAAAATGTGCAAAGTTATTT
GAAAGTGAAAGTGGTGTTCTTGCTCTTTAATTGATTAAAGAATTTCTTTAATTTTATAAC
ATGGATTACTCTAATAGCGTATTCTCTTCTGAAAGTAATTTAAGGGAAGAAGTAAAAAGA
GACAAAATAAATGAAAAATTATCCTTAAATAAACCAGATGCTTAAAAACCATTACTACTC
TAATTACTAGAAGAATTTAAATCTGGACGTAGTAGCATGAACTCAAGTGGAACTCAATCA
GCTGCTCCTAATCCTAATACAGGAGCTTAAAAATAAGAATAAAAAAGTTAACAAGAGGGA
CAAGTCTAAAAAGGTTCTACATAAAGAAGTTAACAAGAGTAATAATAGTAACCTCAATAA
TAATAATAGCAGCTGTAATAATAATAATAACAATAGTAACAATAGCGCTAATAACAAGCT
AACTACCAAGACTTATTAGGCGATGATGAATTTGAATAATCTCTAGATTCATAGAGCGAT
AATAAGAATTTTTAATCATAGAATAAGCCTATGTCATCTCCTTAAAATGATGATAAGAGC
GCTTAAAGCTTAGAAAGTACAAGCGAAAAGAAAGCTCTTCAAGAAGCCTAGTAATTCATT
TAAAAAAGTTAAAACTAAATGCGTACTGGACAAATAGGTTCTTTACCAGTTGGGTAATAA
TAGTAACAATAATAATAGCAATAACAACAATAATAGTAAAGTGCTGTATAATAAAATAAA
TTTAACGCCAACGTGAAATAATATGAACAAGATTAGTTTGATTAATATGATGATGAGATT
GAAGGTGTGGAAGAGCAACTTAATGATTACTAAGAAGATATTGATGTAGATGACGATATT
CTAAACTCAAAAGGAAAGAATGCAGGAGCAAGTAATTAAAGCCATTTTGAAGAGTCAGAA
GACTATATAGGGTAGTCATCAAAGGGTCATGATATTTCAGTTGATTCATATGCATTAGAA
AACTTTGATTATCTCGAAGATGTTGAAGATTAATGA