Identifiers and Description

Gene Model Identifier

TTHERM_01035710

Standard Name

FMT1 (Methionyl-tRNA ForMylTransferase 1)

Aliases

PreTt09582 | 206.m00055

Description

Methionyl-tRNA formyltransferase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

  • hydroxymethyl-, formyl- and related transferase activity (IEA) | GO:0016742

Biological Process

Domains

  • ( PF00904 ) Involucrin repeat
  • ( PF00551 ) Formyl transferase
  • ( TIGR00460 ) methionyl-tRNA formyltransferase
  • ( PF07554 ) Uncharacterised Sugar-binding Domain
  • ( PF07197 ) Protein of unknown function (DUF1409)
  • ( TIGR00639 ) phosphoribosylglycinamide formyltransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.6%

TetraMine Data

TTHERM_01035710

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19643.19.997093137033517e-262formyl transferase (1053 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01035710(coding)
ATGAGTATTAATAAATCTATATCTCTAGGTGTCTTAGCAGATAAATAATAAATCATTATG
TAGTAGGATATATTTTCTCAAAATGGATAAAAAAGTTAAAATTAAAAGCAATAAGAGTCA
TTCATCCCAATAACAAATTTGGATAATCAACAAAACCATGGTTAAAAGTTTGAATCTGAT
GAGTAGGATGAAGAATTTAGGGATGAAACAGAAGAATAAAATTTAATTAACTAACTGATC
TCCATTTTAGGGAATGAAGAATATAAATTACAAATACCTGAAAACTTGAAAAATGAAGCA
TTGGCTTTGTTGAGAACAAAAATGATTATTAATAACTAAAATGGCGGCGAAAACAATACA
ATTTATTAAAATTAGATAAATTAAATTCTTGGAAAAGAGCAGTCTAATAAAAAGAATGAC
GAATAATTTTCGAATTAAAACTCTGGGGCAAAAACTAATTCTTAAAATTAGCAATAAGAA
TAACAACTGAAAATTCAGTAGCTTTAGTAATAGCTTAACAATTAATATGGTTTGAATTAG
GAACTCATAAACTCAAACGAGGAATAAGACAACAGAATACAGTAAGAATACTACAGTGAG
AAAAACAAAAGTAATTAATAGTATTCAAGCTATTAAGCAAATTATTAAACAAAAACTGAT
TAAAATTGGTAGCCTTCTTATTAAGATTAAAGGTATGGACCTCCTGAAAATTCTAAAACT
GATTAGTTTTAACAGAGTTAGCAGTAACCAGTTTCCTTTGCATGCTCTCCTACCACAAAT
ACCAACATTTTAATTCCAAATAATTCTAATGATCCAAAGAGCATCATTAACGTTAACGAT
TTACTAAACAGAGTTAACCCAAAACAATTGTAAAAAGGGAATTAAGAATACAATCAATTG
AATTAAAATCATTTAGAAAATATCACTGAAGAACCTAGTTTCAGCAATAACAATTCAAAC
ACTAAAAATGCAGTTTAAAAGAGACAAACTTCAACTTCTCCGATATCAAAAAGCTAAAAA
ACTTTCAATTAAAATACGAGAGGAAGAACTGATAACAATAGCAGCAATATTAATAGTACC
AGCAGCAACAATAATAGTAGCAACTATGGGTACACATTTAACAATAATAGCTTATTAAAT
AACATTAATAAAAACAACTACAGCAGTACAATCACTAACTAGAATCCTAACTATTTAAAT
AACATGAGTGACAGCGGTAAGAAAAGAACTGCTTCCTCTTCAGTTAAAAAGATAAGCAGA
TCATTCTACAGTTAAAATAATAACAATAACAATAATTTTAATAGCACAAATGGAAGCACT
ATCCTAAATAATAGCTTTACTTATATCAGTAATAGTGGTAATTCATAGAATTACTAGATA
AAATTGCTTAATAAAATATTTTAGAGTGAAAAAGAAAACAATTAAAATGAAATATCTGAT
ATGATAACTCCTTAGAAAAATTCAGGTTCTTTGAATAAAAGATAACGTACCATGACTCAC
TCTCATTCTTTGAATAAGACATTTGCTTAGCCTAGTAAACAATTGTAAAAAAACCCCTAA
GAACTCAAAAAGCTAAAGATTTCTTCTTTCTAAAACTTTAGTCAAGGTGCTATTGGAAAA
CTTTAGATCCTAGAAAACGAAATTAAAAGTAGCTAGGAGCAAAAGAGGTTATTATAGGAA
TAGATAAACTAACTTAAAGCTGATATTGCTCTTGAGAAGAAGTGGTAAGAAGAATCTACC
TTGAACAATTAAGTTCTACAAAACCAAATGAATAATATCAATAAAAACTGCAGTATGCTG
ATTTATGATGGAGTGCAAAAGAAAAAGCTTTTATCTGACTCTAGATTAGAAATAAAGGAA
ATTGAAAATGATAAAGAATAAATTATGAATAAAATTGAAGCTATTAACCAGTAAACTAAG
TAAGAAAAAGAATACATTTACACTTATAAAGTCTTGATAGAAGAGATTAAAAAGCAAATT
AAAAATGAACTTAAATTAAGAAATGATTTAAAAGAAAAAGTACAAAATAACAAAAAAATG
CTTGAGAGCCTATAAGTAAAAAAAGATGCTCTGTTTAATAAAAACTGCACAATCATATAG
AGTGTTGAATAGTCCTTAAATAGGTATTTTGAAAAATAATGA


>TTHERM_01035710(protein)
MSINKSISLGVLADKQQIIMQQDIFSQNGQKSQNQKQQESFIPITNLDNQQNHGQKFESD
EQDEEFRDETEEQNLINQLISILGNEEYKLQIPENLKNEALALLRTKMIINNQNGGENNT
IYQNQINQILGKEQSNKKNDEQFSNQNSGAKTNSQNQQQEQQLKIQQLQQQLNNQYGLNQ
ELINSNEEQDNRIQQEYYSEKNKSNQQYSSYQANYQTKTDQNWQPSYQDQRYGPPENSKT
DQFQQSQQQPVSFACSPTTNTNILIPNNSNDPKSIINVNDLLNRVNPKQLQKGNQEYNQL
NQNHLENITEEPSFSNNNSNTKNAVQKRQTSTSPISKSQKTFNQNTRGRTDNNSSNINST
SSNNNSSNYGYTFNNNSLLNNINKNNYSSTITNQNPNYLNNMSDSGKKRTASSSVKKISR
SFYSQNNNNNNNFNSTNGSTILNNSFTYISNSGNSQNYQIKLLNKIFQSEKENNQNEISD
MITPQKNSGSLNKRQRTMTHSHSLNKTFAQPSKQLQKNPQELKKLKISSFQNFSQGAIGK
LQILENEIKSSQEQKRLLQEQINQLKADIALEKKWQEESTLNNQVLQNQMNNINKNCSML
IYDGVQKKKLLSDSRLEIKEIENDKEQIMNKIEAINQQTKQEKEYIYTYKVLIEEIKKQI
KNELKLRNDLKEKVQNNKKMLESLQVKKDALFNKNCTIIQSVEQSLNRYFEKQ


>TTHERM_01035710(gene)
ATGAGTATTAATAAATCTATATCTCTAGGTGTCTTAGCAGATAAATAATAAATCATTATG
TAGTAGGATATATTTTCTCAAAATGGTAATTCATAAAATACTAAAAAAACATATTAAACA
ATATATTATCAATATAAAAGGATAAAAAAGTTAAAATTAAAAGCAATAAGAGTCATTCAT
CCCAATAACAAATTTGGATAATCAACAAAACCATGGTTAAAAGTTTGAATCTGGTAAATT
ATATAGAATACTTTTTTTAATTATTTATTTTGTTTTTTAGATGAGTAGGATGAAGAATTT
AGGGATGAAACAGAAGAATAAAATTTAATTAACTAACTGATCTCCATTTTAGGGAATGAA
GAATATAAATTACAAATACCTGGTAGATTCTTTAATTTAATTCATATAAAAAGTTATTTT
AGAGACGTAATAAATGAGGTTTGCTAAAATTACTAATTAAACATAGAATTATTATGCCAT
ATTTAATGATATTTTTTTATCTCTAAAAAATATAGAAAACTTGAAAAATGAAGCATTGGC
TTTGTTGAGAACAAAAATGATTATTAATAACTAAAATGGCGGCGAAAACAATACAATTTA
TTAAAATTAGATAAATTAAATTCTTGGAAAAGAGCAGTCTAATAAAAAGAATGACGAATA
ATTTTCGAATTAAAACTCTGGGGCAAAAACTAATTCTTAAAATTAGCAATAAGAATAACA
ACTGAAAATTCAGTAGCTTTAGTAATAGCTTAACAATTAATATGGTTTGAATTAGGAACT
CATAAACTCAAACGAGGAATAAGACAACAGAATACAGTAAGAATACTACAGTGAGAAAAA
CAAAAGTAATTAATAGTATTCAAGCTATTAAGCAAATTATTAAACAAAAACTGATTAAAA
TTGGTAGCCTTCTTATTAAGATTAAAGGTATGGACCTCCTGAAAATTCTAAAACTGATTA
GTTTTAACAGAGTTAGCAGTAACCAGTTTCCTTTGCATGCTCTCCTACCACAAATACCAA
CATTTTAATTCCAAATAATTCTAATGAGTAAAGCAAAATTATTTTTAAATTATAATTTAA
CTTTTTATTTTTTTAAATATGAAAAAAATAAACTAATTAAAATTTCTAAAATAAAATTTA
AAAAAATAATTATAAAAGTCCAAAGAGCATCATTAACGTTAACGATTTACTAAACAGAGT
TAACCCAAAACAATTGTAAAAAGGGAATTAAGAATACAATCAATTGAATTAAAATCATTT
AGAAAATATCACTGAAGAACCTAGTTTCAGCAATAACAATTCAAACAGTAAATACAATGG
TAGCTCAGCTAATAAAAAATAATCCTTTTTTTAAGCTAAAAATGCAGTTTAAAAGAGACA
AACTTCAACTTCTCCGATATCAAAAAGCTAAAAAACTTTCAATTAAAATACGAGAGGAAG
AACTGATAACAATAGCAGCAATATTAATAGTACCAGCAGCAACAATAATAGTAGCAACTA
TGGGTACACATTTAACAATAATAGCTTATTAAATAACATTAATAAAAACAACTACAGCAG
TACAATCACTAACTAGAATCCTAACTATTTAAATAACATGAGTGACAGCGGTAAGAAAAG
AACTGCTTCCTCTTCAGTTAAAAAGATAAGCAGATCATTCTACAGTTAAAATAATAACAA
TAACAATAATTTTAATAGCACAAATGGAAGCACTATCCTAAATAATAGCTTTACTTATAT
CAGTAATAGTGGTAATTCATAGAATTACTAGATAAAATTGCTTAATAAAATATTTTAGAG
TGAAAAAGAAAACAATTAAAATGAAATATCTGATATGATAACTCCTTAGAAAAATTCAGG
TTCTTTGAATAAAAGATAACGTACCATGACTCACTCTCATTCTTTGAATAAGACATTTGC
TTAGCCTAGTAATTAAATTATATTAAAAGCCCAGCAGTTATTTATAAATTTTTTGTATTC
TTTAGGTAAACAATTGTAAAAAAACCCCTAAGAACTCAAAAAGCTAAAGATTTCTTCTTT
CTAAAACTTTAGTCAAGGTGCTATTGGAAAACTTTAGATCCTAGAAAACGTAAAAATAAA
AATTTTTATAATTTTATTTTTACTTAAATAAAAAACTTAAAAAAGGAAATTAAAAGTAGC
TAGGAGCAAAAGAGGTTATTATAGGAATAGATAAACTAACTTAAAGCTGATATTGCTCTT
GAGAAGAAGTGGTAAGAAGAATCTACCTTGAACAATTAAGTTCTACAAAACCAAATGAAT
AATATCAATAAAAACTGCAGTGTAAATTTGATTTAAAATAATTTTTCGATATATGAATAT
TCCATTTGTAATTTAGATGCTGATTTATGATGGAGTGCAAAAGAAAAAGCTTTTATCTGA
CTCTAGATTAGAAATAAAGGAAATTGAAAATGATAAAGAATAAATTATGAATAAAATTGA
AGCTATTAACCAGTAAACTAAGTAAGAAAAAGAATACATTTACACTTATAAAGTCTTGAT
AGAAGAGATTAAAAAGCAAATTAAAAATGAACTTGTAAATTTTTTAAATTCACATAAACA
AAAATAAAATTTAAATTATTTTTTTAGAAATTAAGAAATGATTTAAAAGAAAAAGTACAA
AATAACAAAAAAATGCTTGAGAGCCTATAAGTAAAAAAAGATGCTCTGGTATAATTATTT
TTTTTTATATTTTAAATTTAAATTAATTTACTTTTTTTTATAGTTTAATAAAAACTGCAC
AATCATATAGAGTGTTGAATAGTCCTTAAATAGGTATTTTGAAAAATAATGA