Identifiers and Description

Gene Model Identifier

TTHERM_00316630

Standard Name

FLP7 (FLiPpase)

Aliases

PreTt20974 | 31.m00276 | 3687.m00078

Description

phospholipid-translocating P-type ATPase, flippase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00122 ) E1-E2 ATPase
  • ( TIGR00099 ) Cof-like hydrolase
  • ( TIGR00338 ) phosphoserine phosphatase SerB
  • ( PF00702 ) haloacid dehalogenase-like hydrolase
  • ( PF09229 ) Activator of Hsp90 ATPase, N-terminal
  • ( TIGR01484 ) HAD-superfamily hydrolase, subfamily IIB
  • ( TIGR01517 ) calcium-translocating P-type ATPase, PMCA-type
  • ( TIGR01652 ) phospholipid-translocating P-type ATPase, flippase
  • ( TIGR01494 ) ATPase, P-type (transporting), HAD superfamily,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00316630

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_77790
WormBaseWBGene000191669.997093137033517e-262locus:tat-2 status:Partially
_confirmed UniProt:U4PRL1
protein_id:CDH93216.1
Tetrahymena borealisEI9_08413.19.997093137033517e-262phospholipid-translocating P-t
ype ATPase, flippase (1332 aa)
DictyBaseDDB_G02693809.997093137033517e-262DDB_G0269380 on chromosome: 1
position 2645714 to 2650717
OxytrichaContig19960.0.g519.997093137033517e-262E1-E2 ATPase
SGDYAL026C9.997093137033517e-262DRS2 Aminophospholipid translo
case (flippase) that maintains
membrane lipid asymmetry in p
ost-Golgi secretory vesicles;
contributes to clathrin-coated
vesicle formation and endocyt
osis; mutations in human homol
og ATP8B1 result in liver dise
ase

General Information

Paragraph NoGene NameParagraph Text
19FLP11,
FLP18,
FLP17,
FLP8,
FLP16,
FLP15,
FLP14,
FLP6,
FLP13,
FLP10,
FLP2,
FLP1,
DNF1 ,
FLP9,
FLP12,
FLP4,
FLP7,
FLP5,
FLP19
The phospholipid flippase family of genes in Tetrahymena contains 20 members, FLP1-FLP20. Preliminary studies show that many of these genes are differentially regulated in response to temperature and/or the presence of a polycyclic aromatic hydrocarbon (pyrene).

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00316630(coding)
ATGGGATCCCTACTTGGCAGTTAAGCTAAGTCTTATGATTAAGATAGAATTTTTACTGCT
TTTCAAGACGAAGAAGCTTTGAAACATAAACATTAGCATCTTAACGAAAGCAACTCTAAA
AAGTTTCCATCTAATTTCATTAAAACTTCTAGGTATACAGCAGTTTCATTCTTACCTATG
AGCTTATTGCTCTAATTTTAGAGATACGCAAATATTTACTTTTTAGTTACTGCAATTCTT
CAATGCATTCCCCAAATATCTCCTTTGAGCCCTTTTGTTGCAGTTGCTCCTCTTATTTTT
GTACTTGCTGTTTCTATGGCTCGTGAAGGATATGAAGATTATCAAAGACACAAGAGTGAT
AATGAATAAAATTTTTCAGCAAAAACAAAGAGAGTCCTCCAAGATAGAGGTGAGGAAGAT
GTAGCTTGGGCTAATGTCCATGTTGGAGATATTCTACATATTTATCAAGATGAATGCTTT
CCCACTGATCTACTTGTATTAGGAAGTAACCTAGGTGGTGTGTGCTATATCGAAACAGGT
GCACTTGATGGTGAAAAAAATTTAAAGCCAAAGTCAGCCATTAATGAAACTTCATCATAT
TTCTCCACAAAAGAAGATAACGTTGCTACATTATCAACAGGAAATCTATTTACCAACAAA
TAAACAAACTTTAATTTAACCATAAAAGCTAATAAACCAGATTAGGATCCTAATCACTTT
ATTGGTAGTATAGGATTTTAGCTACAAAATGACAATAATCCTTAAAGTGCCAAGCAAATC
CCTGCAGATTCTACTTAATTTGTACCAAGAGGTGCATTCCTAAGAAATACAGAAAGTATT
TATGCTGTAGTTGTTTATACAGGTATGGATACAAAAATTATGAAAAATGCAGAAGAGGGA
AAAGCAAAATCGAGTGACATGGAAGCAAAAATGAACAAATTCATTCTAGGAATTCTTATT
TTCTAGTTTTTATGTTGTTTTGTGATGAGTTCTTGCTCATATTACTGGCTAGATAAAAAC
CATATATATTATCCCTATCTTGACTTGGACAAAGATGGTCTTTCCTATATTTCTCAATCT
GTTTTAGTCTATTTCTCTTATTTTATTCTTTTTAATACAATGATTCCAATTTCACTTGTT
GTTTCACTTGAAATGGTTAAGGTCCTACAATCATACTTCATTACAAATGATTATGAAATG
TATTCTCACCACAATTAGAGATGGCCAAGAGTACTCACATCTACAATTAACGAAGAACTA
GGTTAGGTTGAATATGTCTTTTCTGATAAGACAGGTACTCTCACTCAAAATTAAATGCAA
TTTAAAATGGCTGTAATAGGTAACACTCTTTATGGTGAAAAAGCTGCTTAAAAAAAGAAA
GCCGCTGTATAGCCTTCTAAACAATAAAAAAGTAACACCAAATAGCATCAACATACAGAA
TTTGTTTTTGAAGATGATAATTTAACTAATCTCCTTTCAAGAAAAGCTGAAAAGTCTTAG
AATCCTCCAGTTAACATCACTCTTAAATCAAAGGATGGCAAAGCTACTTACACTATTCCT
AGCTAGTACGAACTATCAAGAGAATATTTCAAAAATTTAGGTTTAGCTCATGAATGTATT
GTAGAGAAAAATAAGGATCCTAATGATACAAATTATTATTACTAAGGTCCCTCTCCGGAT
GAAATCACTCTAGTTGATGCTGCGTATCATATGGGATTTACATTTGTTGGAAAAACTAGT
AACAAACTTATGATGAATTTGACAGATACAGCTGGAAAAGAAGGCTAATAAGAATTTACT
AAAATTAATGTTTTCGAATTTAGCAGTGCGAGAAAACGTATGACTCTTTTATTAGAAGAT
AATGGAGTTTATAAAATGTACGTTAAGGGTGCTGATAATGTGATTAAAGAGCGTCTCGAT
AAGGGTATCCATTAGCCATACTTAGATTTTGCAGATAAAAAGTTAACAGAATTTTCTCTT
GTTGGTTTACGTACTTTATTGATTGGTTTTAAAATTCTCTCCAAAGATGAAGTTGATGCA
TTTGTCAATAAATATAACAATTTGGCTAACTCTGCAAATAGAAAAGAAGACTTAGAGAAA
TTAGCTGATGAAGTAGAATAAGGGTTTTTCTTATTAGGAGCAACAGCTGTGGAAGATAAA
TTGTAAGATGATGTCCCAGAAACTATTCATGATCTACTTCGTGCCAATATTAAAGTATGG
ATGCTTACTGGTGATAAATTAGAGACAGCTGAAAATATTGCAAAAAGCTGTAAGCTTATT
CTAGAAGATTTTGAATTACTTGTTATGAGTGATAAAAATCCTAAAGTTATCCGTAAAGAA
ATGACAGAAATCCTATGGAAAAGATTTAAAAAACTGAAAGAAGATAAAGTTCGTAAATGC
TTTTTAGTAGAAGGTGATTGTCTAAAGGTCATATTTGAAAAAGGTAATGAAGATATCAAA
AAAAAATTTGTTTAAATTACCAAAGATTGCGAAAGTGTTGTATGCTGCAGAGTATCTCCA
GTCTAAAAAGCATAAGTAGTTAGATCTATAAGAGAAGGACTTAACAAAATCACTTTAGCA
ATTGGTGATGGAGCCAATGATGTTAACATGATTCAGGCAGCCCACATTGGATGTGGTATA
TATGGTAATGAAGGTATGCGTGCAGTATAAAGCAGTGATTTCGCTTTTGGATAATTTAAA
TGCTTATGGAGACTTCTTTTTGTACATGGAAGATGGTCATACATTAGAATCTCTGAAATG
ATTGTCTATTTCTTCTATAAAAACATGATTTTTACTATTCCTTAGCTTTATTTTGCTTTC
TTTAGTGGCTTTTCTGCACAAAGTATCTTTGATGATTACTATATATCTATGTATAATCTT
ATTTTTACTGCTCTACCCTTAATCATTAGAGCTATTTTTGATTAAGACGTAAACTACATG
TACATATAGTACGATAGAAAACTTGTATAAACAGGAGATGAAAATGAAAAGAGAAGATTA
TAAAAGCTTATAAATAAACGTAAAGACTATATTAGAGATAGATTACCCAATCTCTATTAT
TTAGGTCAAAAGCAATAACTTTTTTCAACAAGAATATTCCTTGAGTGGTTAATTTAAGGT
ATTGTACATGGTATATTCATATTCTTTGGTAGCTATTTCACAGTAGGTAATATAACATTA
GCTTCTGATGGCTATACCTCAGATATGTGGTCATTCTCATTAATTATATTCACATCTGTT
GTATTTATTGCTGATCTTAAGTTAGCTATTTACACAAGGTACTGGACTTTAATAAATTAT
TTAGCCTTCTACATCACAAGTATAGGTCTCTACATAGCTGCCTTCTTTATCACTGGTGTT
TTGTATAACAGTTATGTTTATGAAACACCAAACTATTTGGTATAAACACCTCATTTCTAT
CTAGTTATTTTCTTCATAGTAGCAGGAATATTTGCATTTGATATGTTTGTCTATGCTTCT
AAAGAATTATTCCATAATAAGACAAAAGAAAAAGCCCTTAGAAGGCTAATGAAGGAGCAG
CCTAAGAAGAGTAATGAAAATAAATGGATTTTCTAAGGCTCAGCAATCGAATTAGAGAGT
AACTTGAACAGCTTTAAAGACAAATTTGATGAGGAAAGCTAAATCATGCTCAGTGCAATA
AATTTAAATAAAAAAGATGAAAAATAATACATCGAACCCTAAACTATCTTCATGAATGGT
TAAGGAAACAAAGGTACTGAAGTTTAATTTTTGTCCAGCTCAAACTAAGATTGTAAAAAA
AATAATAATACTCTGCCTAAGAGCACAATCAAAGAAAATGTCAGTGGTCATCATCTTTAA
GTTTAAACTTCCCCTACTCCATTATATAATAATATTTAAAATACACCAAACTCAAATAGG
AATGGTGATGAATTAATTTAATTTACATTCACTGACAGCAATGATGATGATTACGATATT
TATTATAAATAATAATTCAATTTTAATACGGATTTATAACCCTAAACTATATAAAAAGTT
GACGAGAGGAAAGATAACAATATAGGATTGCCACCTTCTAAATAATTCCATTCTAAGCAA
GAAATTGAATTAGATGACTGA


>TTHERM_00316630(protein)
MGSLLGSQAKSYDQDRIFTAFQDEEALKHKHQHLNESNSKKFPSNFIKTSRYTAVSFLPM
SLLLQFQRYANIYFLVTAILQCIPQISPLSPFVAVAPLIFVLAVSMAREGYEDYQRHKSD
NEQNFSAKTKRVLQDRGEEDVAWANVHVGDILHIYQDECFPTDLLVLGSNLGGVCYIETG
ALDGEKNLKPKSAINETSSYFSTKEDNVATLSTGNLFTNKQTNFNLTIKANKPDQDPNHF
IGSIGFQLQNDNNPQSAKQIPADSTQFVPRGAFLRNTESIYAVVVYTGMDTKIMKNAEEG
KAKSSDMEAKMNKFILGILIFQFLCCFVMSSCSYYWLDKNHIYYPYLDLDKDGLSYISQS
VLVYFSYFILFNTMIPISLVVSLEMVKVLQSYFITNDYEMYSHHNQRWPRVLTSTINEEL
GQVEYVFSDKTGTLTQNQMQFKMAVIGNTLYGEKAAQKKKAAVQPSKQQKSNTKQHQHTE
FVFEDDNLTNLLSRKAEKSQNPPVNITLKSKDGKATYTIPSQYELSREYFKNLGLAHECI
VEKNKDPNDTNYYYQGPSPDEITLVDAAYHMGFTFVGKTSNKLMMNLTDTAGKEGQQEFT
KINVFEFSSARKRMTLLLEDNGVYKMYVKGADNVIKERLDKGIHQPYLDFADKKLTEFSL
VGLRTLLIGFKILSKDEVDAFVNKYNNLANSANRKEDLEKLADEVEQGFFLLGATAVEDK
LQDDVPETIHDLLRANIKVWMLTGDKLETAENIAKSCKLILEDFELLVMSDKNPKVIRKE
MTEILWKRFKKLKEDKVRKCFLVEGDCLKVIFEKGNEDIKKKFVQITKDCESVVCCRVSP
VQKAQVVRSIREGLNKITLAIGDGANDVNMIQAAHIGCGIYGNEGMRAVQSSDFAFGQFK
CLWRLLFVHGRWSYIRISEMIVYFFYKNMIFTIPQLYFAFFSGFSAQSIFDDYYISMYNL
IFTALPLIIRAIFDQDVNYMYIQYDRKLVQTGDENEKRRLQKLINKRKDYIRDRLPNLYY
LGQKQQLFSTRIFLEWLIQGIVHGIFIFFGSYFTVGNITLASDGYTSDMWSFSLIIFTSV
VFIADLKLAIYTRYWTLINYLAFYITSIGLYIAAFFITGVLYNSYVYETPNYLVQTPHFY
LVIFFIVAGIFAFDMFVYASKELFHNKTKEKALRRLMKEQPKKSNENKWIFQGSAIELES
NLNSFKDKFDEESQIMLSAINLNKKDEKQYIEPQTIFMNGQGNKGTEVQFLSSSNQDCKK
NNNTLPKSTIKENVSGHHLQVQTSPTPLYNNIQNTPNSNRNGDELIQFTFTDSNDDDYDI
YYKQQFNFNTDLQPQTIQKVDERKDNNIGLPPSKQFHSKQEIELDD


>TTHERM_00316630(gene)
ATGGGATCCCTACTTGGCAGTTAAGCTAAGTCTTATGATTAAGATAGAATTTTTACTGCT
TTTCAAGACGAAGAAGCTTTGAAACATAAACATTAGCATCTTAACGAAAGCAACTCTAAA
AAGTTTCCATCTAATTTCATTAAAACTTCTAGGTATACAGCAGTTTCATTCTTACCTATG
AGCTTATTGCTCTAATTTTAGAGATACGCAAATATTTACTTTTTAGTTACTGCAATTCTT
CAATGCATTCCCCAAATATCTCCTTTGAGCCCTTTTGTTGCAGTTGCTCCTCTTATTTTT
GTACTTGCTGTTTCTATGGCTCGTGAAGGATATGAAGATTATCAAAGACACAAGAGTGAT
AATGAATAAAATTTTTCAGCAAAAACAAAGAGAGTCCTCCAAGATAGAGGTGAGGAAGAT
GTAGCTTGGGCTAATGTCCATGTTGGAGATATTCTACATATTTATCAAGATGAATGCTTT
CCCACTGATCTACTTGTATTAGGAAGTAACCTAGGTGGTGTGTGCTATATCGAAACAGGT
GCACTTGATGGTGAAAAAAATTTAAAGCCAAAGTCAGCCATTAATGAAACTTCATCATAT
TTCTCCACAAAAGAAGATAACGTTGCTACATTATCAACAGGAAATCTATTTACCAACAAA
TAAACAAACTTTAATTTAACCATAAAAGCTAATAAACCAGATTAGGATCCTAATCACTTT
ATTGGTAGTATAGGATTTTAGCTACAAAATGACAATAATCCTTAAAGTGCCAAGCAAATC
CCTGCAGATTCTACTTAATTTGTACCAAGAGGTGCATTCCTAAGAAATACAGAAAGTATT
TATGCTGTAGTTGTTTATACAGGTATGGATACAAAAATTATGAAAAATGCAGAAGAGGGA
AAAGCAAAATCGAGTGACATGGAAGCAAAAATGAACAAATTCATTCTAGGAATTCTTATT
TTCTAGTTTTTATGTTGTTTTGTGATGAGTTCTTGCTCATATTACTGGCTAGATAAAAAC
CATATATATTATCCCTATCTTGACTTGGACAAAGATGGTCTTTCCTATATTTCTCAATCT
GTTTTAGTCTATTTCTCTTATTTTATTCTTTTTAATACAATGATTCCAATTTCACTTGTT
GTTTCACTTGAAATGGTTAAGGTCCTACAATCATACTTCATTACAAATGATTATGGTAAG
AATTTATTTATTCATTTTATATTAAAAATCAATAGGTATTAAGCAATTAATTTTTTATTA
ATTTTTAAAATAAACAAAAAAATTTTCTATCTTTGAGTAAAGGTGAAAATATTTTTTTTG
TCTCCAATATTATTCTACATTTTCTCACTTAAATTTACAGAAAAATACACAAAAAGATTT
TTTTAATTTCACAGTTTACAATTAATTATTCTTAAATTTAATTTTAGTTGGTTCAATTTT
TCAAACGCAAAATTTTTAATTCGAATATATTTTTGACAATTAATTATTTTGCGTTAAATT
CATCAAAAATCTTAATATCTATTTAGAAAATTTAGATTTTTTTCTAATTAATCATATTAT
CAGTTGATTACTTCTTAATAATTCAAAAAAAATTTAATTTAAATAAAAATACTACCTATT
TATTTAATATCCTTTTTTTATCTTTGACTTCAACATAAAATTTTAATGACATTTAGAAAT
GTATTCTCACCACAATTAGAGATGGCCAAGAGTACTCACATCTACAATTAACGAAGAACT
AGGTTAGGTTGAATATGTCTTTTCTGATAAGACAGGTACTCTCACTCAAAATTAAATGCA
ATTTAAAATGGCTGTAATAGGTAACACTCTTTATGGTGAAAAAGCTGCTTAAAAAAAGAA
AGCCGCTGTATAGCCTTCTAAACAATAAAAAAGTAACACCAAATAGCATCAACATACAGA
ATTTGTTTTTGAAGATGATAATTTAACTAATCTCCTTTCAAGAAAAGCTGAAAAGTCTTA
GAATCCTCCAGTTAACATCACTCTTAAATCAAAGGATGGTAATTAATTTTTATTTCGATC
CTTCAATATTATTTACCTTAAAATAAAATACAAAAATCTTACAAACATTTTAATTAATTA
ATTAAAAAGGCAAAGCTACTTACACTATTCCTAGCTAGTACGAACTATCAAGAGAATATT
TCAAAAATTTAGGTTTAGCTCATGAATGTATTGTAGAGAAAAATAAGGATCCTAATGATA
CAAATTATTATTACTAAGGTCCCTCTCCGGATGAAATCACTCTAGTTGATGCTGCGTATC
ATATGGGATTTACATTTGTTGGAAAAACTAGTAACAAACTTATGATGAATTTGACAGATA
CAGCTGGAAAAGAAGGCTAATAAGAATTTACTAAAATTAATGTTTTCGAATTTAGCAGTG
CGAGAAAACGTATGACTCTTTTATTAGAAGATAATGGAGTTTATAAAATGTACGTTAAGG
GTGCTGATAATGTGATTAAAGAGCGTCTCGATAAGGGTATCCATTAGCCATACTTAGATT
TTGCAGATAAAAAGTTAACAGAATTTTCTCTTGTTGGTTTACGTACTTTATTGATTGGTT
TTAAAATTCTCTCCAAAGATGAAGTTGATGCATTTGTCAATAAATATAACAATTTGGCTA
ACTCTGCAAATAGAAAAGAAGACTTAGGTAAAGTTTTTTTATTTTTCATATTTTCTAACT
TGATTGCTTGTTACTATGAATGAAAATTAACTTCTATCCACTAAATACAACAGAGAAATT
AGCTGATGAAGTAGAATAAGGGTTTTTCTTATTAGGAGCAACAGCTGTGGAAGATAAATT
GTAAGATGATGTCCCAGAAACTATTCATGATCTACTTCGTGCCAGTAATAAATTTTTATT
ATTTGAAAATTAATTGAGAGTTGAAAAAACAAAAAAATTCTACAAGTTTAAAAATTAATC
TATTAATTTATTTATATTTTATTGAATAAAAAAAGATATTAAAGTATGGATGCTTACTGG
TGATAAATTAGAGACAGCTGAAAATATTGCAAAAAGCTGTAAGCTTATTCTAGAAGATTT
TGAATTACTTGTTATGAGTGATAAAAATCCTAAAGTTATCCGTAAAGAAATGACAGAAAT
CCTATGGAAAAGATTTAAAAAACTGAAAGAAGATAAAGTTCGTAAATGCTTTTTAGTAGA
AGGTGATTGTCTAAAGGTCATATTTGAAAAAGGTAATGAAGATATCAAAAAAAAATTTGT
TTAAATTACCAAAGATTGCGAAAGTGTTGTATGCTGCAGAGTATCTCCAGTCTAAAAAGC
ATAAGTAGTTAGATCTATAAGAGAAGGACTTAACAAAATCACTTTAGCAATTGGTGATGG
AGCCAATGATGTTAACATGATTCAGGCAGCCCACATTGGTAAAATTATTAAAATATTTCA
TTTCTTACATCACCATAATATTATGTTCATTTAAAAAAAGGATGTGGTATATATGGTAAT
GAAGGTATGCGTGCAGTATAAAGCAGTGATTTCGCTTTTGGATAATTTAAATGCTTATGG
AGACTTCTTTTTGTACATGGAAGATGGTCATACATTAGAATCTCTGAAATGATTGTCTAT
TTCTTCTATAAAAACATGTAAAATCAATTAATAATATTAAAAATTTTGAACTTAATTATC
AATGTTTTATTTTTTTAATTTATTTAATGGATTAATTTTATTAACTTTAAGAAAATATAC
CATAAGCTAATATTTTTTTAATCATCAATACCATTGTGTAATATGGATTATTAATACAAT
CAAAAAGATAAAAATATTTTTATTATTATTTTGATTAATGCAAAAAAATGAATATTATTT
ATTGTTAGTGATTATTAATGAATTTATGAAATTGTTAATAATCAAAAATAGGATTTTTAC
TATTCCTTAGCTTTATTTTGCTTTCTTTAGTGGCTTTTCTGCACAAAGTATCTTTGATGA
TTACTATATATCTATGTATAATCTTATTTTTACTGCTCTACCCTTAATCATTAGAGCTAT
TTTTGATTAAGACGTAAACTACATGTACATATAGTACGATAGAAAACTTGTATAAACAGG
AGATGAAAATGAAAAGAGAAGATTATAAAAGCTTATAAATAAACGTAAAGACTATATTAG
AGATAGATTACCCAATCTCTATTATTTAGGTCAAAAGCAATAACTTTTTTCAACAAGAAT
ATTCCTTGAGTGGTTAATTTAAGGTATTGTACATGGTATATTCATATTCTTTGGTAGCTA
TTTCACAGTAGGTAATATAACATTAGCTTCTGATGGCTATACCTCAGATATGTGGTCATT
CTCATTAATTATATTCACATCTGTTGTATTTGTAAGTTTTATAACAAAATCAAATAATTA
GCTGTAATTTTTAATATTAACATTTAACAATTTAAAAGATTGCTGATCTTAAGTTAGCTA
TTTACACAAGGTACTGGACTTTAATAAATTATTTAGCCTTCTACATCACAAGTATAGGTC
TCTACATAGCTGCCTTCTTTATCACTGGTGTTTTGTATAACAGTTATGTTTATGAAACAC
CAAACTATTTGGTATAAACACCTCATTTCTATCTAGTTATTTTCTTCATAGTAGCAGGAA
TATTTGCATTTGATATGTTTGTCTATGCTTCTAAAGAATTATTCCATAATAAGACAAAAG
AAAAAGCCCTTAGAAGGCTAATGAAGGAGCAGCCTAAGAAGAGTAATGAAAATAAATGGA
TTTTCTAAGGCTCAGCAATCGAATTAGAGAGTAACTTGAACAGCTTTAAAGACAAATTTG
ATGAGGAAAGCTAAATCATGCTCAGTGCAATAAATTTAAATAAAAAAGATGAAAAATAAT
ACATCGAACCCTAAACTATCTTCATGAATGGTTAAGGAAACAAAGGTACTGAAGTTTAAT
TTTTGTCCAGCTCAAACTAAGATTGTAAAAAAAATAATAATACTCTGCCTAAGAGCACAA
TCAAAGAAAATGTCAGTGGTCATCATCTTTAAGTTTAAACTTCCCCTACTCCATTATATA
ATAATATTTAAAATACACCAAACTCAAATAGGAATGGTGATGAATTAATTTAATTTACAT
TCACTGACAGCAATGATGATGATTACGATATTTATTATAAATAATAATTCAATTTTAATA
CGGATTTATAACCCTAAACTATATAAAAAGTTGACGAGAGGAAAGATAACAATATAGGAT
TGCCACCTTCTAAATAATTCCATTCTAAGCAAGAAATTGAATTAGATGACTGA