Identifiers and Description

Gene Model Identifier

TTHERM_01166280

Standard Name

FLP19 (FLiPpase)

Aliases

PreTt28819 | 261.m00027

Description

phospholipid-translocating P-type ATPase, flippase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00702 ) haloacid dehalogenase-like hydrolase
  • ( TIGR01484 ) HAD-superfamily hydrolase, subfamily IIB
  • ( TIGR01116 ) calcium-translocating P-type ATPase, SERCA-type
  • ( TIGR01652 ) phospholipid-translocating P-type ATPase, flippase
  • ( TIGR01494 ) ATPase, P-type (transporting), HAD superfamily,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01166280

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_52170
WormBaseWBGene000191669.997093137033517e-262locus:tat-2 status:Partially
_confirmed UniProt:U4PBV8
protein_id:CDH93219.1
Tetrahymena borealisEI9_10192.19.997093137033517e-262phospholipid-translocating P-t
ype ATPase, flippase (1532 aa)
DictyBaseDDB_G02693809.997093137033517e-262DDB_G0269380 on chromosome: 1
position 2645714 to 2650717
SGDYAL026C9.997093137033517e-262DRS2 Aminophospholipid translo
case (flippase) that maintains
membrane lipid asymmetry in p
ost-Golgi secretory vesicles;
contributes to clathrin-coated
vesicle formation and endocyt
osis; mutations in human homol
og ATP8B1 result in liver dise
ase
OxytrichaContig10486.0.g721.0000509032773212e-171E1-E2 ATPase

General Information

Paragraph NoGene NameParagraph Text
19FLP11,
FLP18,
FLP17,
FLP8,
FLP16,
FLP15,
FLP14,
FLP6,
FLP13,
FLP10,
FLP2,
FLP1,
DNF1 ,
FLP9,
FLP12,
FLP4,
FLP7,
FLP5,
FLP19
The phospholipid flippase family of genes in Tetrahymena contains 20 members, FLP1-FLP20. Preliminary studies show that many of these genes are differentially regulated in response to temperature and/or the presence of a polycyclic aromatic hydrocarbon (pyrene).

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01166280(coding)
ATGTCGCACAAAGTGAGAGACTAAGAAGAATCTAACAGATAAACAATATATCTTAATGAT
CGTACATAAAATCAATTGATTCATAGAAAGTTTTACAATCATATAAAGACATCAAAATAC
ACATGGTGGAACTTTGTTCCAAAGGCGTTGATTTTGCAATTTATGAGAGCAGCTAATTTT
TATTTCTTAATTTCTACTGTTGTCCAATGTATAGATATCATTTCCCCTTTAGCGCCTTTT
TCCGCGGTTGGCCCACTCATATTAGTGCTTGCCGTATCTTTATCAAGAGAAGCAATTGAA
GATTATAAAAGACACCGCAATGACGATCTTGTCAACGAATAGAAATCATTTATTTTTAAT
AACAAAAACTTTACAAGCATTATGTGGAAGGATATTTAGCTTGGCGATATTATAAAAGTT
AACTAAGAGCAGATATTGCCAGCAGATATTTTGGTTATTACAACAAATGAAGAAAACGGC
ACAGGTTTTGTCGAAACTGCTAACTTGGATGGTGAGAGAAACCTAAAAAGCAAAATATCT
CATGAGATTGTAAACAAGTACGGTAGAGAACATTCTCTCATTAAATTCAAGGGAAAAATT
GTTTGTGATAAACCTAACAACAGAATCCATAGTTTCAAAGGTTTGCTCTATTTGGACGAC
GAATCGAAACCAATAGTACTCAACAATAATAATGTCATGCTCAGAGGCACAACTTTAAAG
AATACTGAATGGGTGATAGGAGTGGTAATTTATTCAGGTCAAGACACGAAAATAATGAGG
AACTAAGGGCAAGTGAAGCACAAATCTACTCATATAGAAAAGAAAGTGAATCCTATAATT
TTTATAACATTGTTAGTTCAATTAGCTCTATGCATTATTATGGCTATTCTTCTATCTATT
TTTTAGAAAAACACAAATCCTTTGGAAAATAATAAATATAACTACGCTTATCTTTATGGA
AACAGTAGCGATGGTCTTTATAGCTATGAAGTTTAGGGAACAATCAATTTTTTTTCATAC
TTTTTACTATTAAATTCACTTATTCCTATTTCTTTGATTATTTCTATGGAAGTTGTCAAA
CTATTTTAATCATCTTTCATGGAGTATGATGCTGAAATGCACTATTTAGACGATGGATAA
GTTCAAAAAATGAAGGTGCTCAATACTATGATTCATGAAGAGTTAGGAAAAATTGATTAC
ATCTTTACAGATAAAACAGGAACATTGACTTGCAACATTATGATTTTCAGACATGCAAAT
ATCGCTGGTTCTGACTACTCTGAAAAAGAACTTGAAGACATCTTAGCAAAATTAGAGTAT
CAAACTCTCACTTACGATGAAGAATACAAAGATTTTTATCAATTTTGGATGTGCATTGCT
ATTTGTCACGACGTTATCCTTGAGGAAAAACAAAACGAAATTAATTATTAAGGTTCATCA
CCAGATGAAGTATGTCTCGTAGAAAAAGCTCAAAAATATAATTTCAAATTTCTCAAAAGA
ACAACAAATTAAATATTTATACAAGTGGGATCAGAAATGCATACATTTAAGCTTCTCAAT
AAAATAGAATTCACAAGTGAGCGTAAAAGAATGAGTGTCATTATTTAGGATCCAATAACA
GGAAAAATATATATGTACACTAAGGGAGCTGATTCGTTCATGCTCAAACATATTTCGAAT
ACAAGTGAAGCACTTAAAAGTAATATAAAGCAAAGCCTCAAATACTATTCAAAGCACGGG
TTAAGAACTCTCTGCTTGGGTATGAAAGAGTTAAATCAATAAGAATATGATGCATGGAAT
TCGCAAATACAGGATTTAAATATGAACATGATTGGAGACTTGTTCCCTGAAAAAACTAAA
GATAAAATTGCTGATCTTGAAAATGAGATAGAAACAGGCTTTGATCTTTTGGGAGTTACT
GCACTTGAAGATAAATTGCAAGAAGGAGTTCCTGAAGTTTTAAAGGATTTCCATGAAGCT
GGAATCAATGTTTGGATGCTCACAGGTGACAAACTTGAAACAGCAGAAAATATTGGTTAT
CTTTGCAACTTGCTGAACAATCAAACTAAAGTGTTCAGAGTTCAATCTCACTATCCAGAC
GTTACGAGAGACAAGTTCTTTAGAATAAAGGGAAGAATCAACCAAATAAAAACTGTCAGC
GAAATAGGAGAAATAAGAATAAAAAACAACTAAAATAACCACCATGATTTCAAAAACAAA
AAAGTTGGACATTAAAACCAGAATATAAACAGAATAATAAACGATGGAGGTTCCTAATCG
AGACGAGATTCCTATCTAACTAAAGAAGAAAATAATTCATTTGAAATAAACTAAGTGAAA
GGCTACACAGGATTTGCCTTGGTAATAGAAGGAGAAGCAATCGGTCATGCCTTACATGAT
GATTAATGTAGAAAAGAGTTCTTGCAAATCATTCCAGAATGCTGCACTGTTATATGCTGC
AGATCAACTCCAACATAAAAAGCAGAAATGGTCAAATTCGTTAAAACTCATTTTAATAAA
ACTTGTCTAGCTGTCGGAGATGGAGGTAATGACGTAACCATGATCTAAGAAGCAGATATC
GGAGTTGGTATTATTGGTAAGGAAGGAAATCAAGCAGCTTTAAGCAGCGATTATTACTTT
GGGTAGTTTAGGTTTTTGTGGAGACTTTTGTTTGTTCATGGGAGATGGAATTTATACAGA
ACATCTTACTTTGTTAACTATTTCTTCCTTAAAAATTTTATTTTCACACTTCAATAGTTC
TACTTTGGGTTCTTTTGTGCTTATTCAGGGTAGTCTTTTTGGGAAGACGGTTATTTACTC
AATTTCAACTCTATTATTACTGCTTGTGCTCCAGTTTATTTTGCAGGGTTTGAGTAAGAT
GTCAATCCTCATGGATCTGAGTACATCGCTAAGTATTTGCCTCGTCTCTACAAAATATTT
AGAGAAAAAGATCTTTTTTCTTTTAAGGTCTTCGGAATAGTTTTCTTATAAGGTGTTGGC
CTTTCTCTTACAACTTATTTTTCTGTATTTTTTATCAACTATTAGGATTACTATTAGATG
AGCGGAGATGGTAAAATCGATGGTTTGTGGTTTTAAAGCTTTTCTTCTTACTGCAGCACA
GTTGGAGTGGTTTGGGCTATCAATTTTATGGACACAACATATTTTTCACCATTTACTTTC
TTTTCTTACGTGATTGTTAGTTTGTTCTTATTCTTCCCTGCTTTCGCTTTTACTTATGAC
ATTTTTGCTGGTCCCTTGCAAGAAATGTTACTTATAAACATTGGAAATTGGAAATTCTGG
TTGACTTTGTTCTTAAATGTTGCTTTTATCTGTATTATTAAATACACATATAAAGTTTAC
AGATACATATTTGCTCCAGAATTAGTTCATGATTTGCAATATCACAGAAAGAAGTTAAAC
GAAGCTGAGAAGTAAGTTAAAAATCAATAAACTGATCCTAATATTAATAATAGCAATAAT
GCTAAAAATAACAACAACAATAATAATGCCTACACTACTCCTGAAAATGGTTTACAAATC
GAAATTGCAGATAATATCCAATAAAATGAAATTGCACTCTAAAATCCATCTAAAAAATCT
GTAGAATTAGAACATAAATAAGAAAAGGCTTCAAAGAGGACTGCGTCTTTATAAAATGTG
GAACACTAACAAAATTTAAATGTCGAATTTACTGATTTAAAACTTTAAATGAATCATGAT
CTAGATAAAGGCAGTGGAAGAAAATTAAATAAACCTCAAAGCTAAAATTTCATCACTATT
TAAAATAATGATTAGAGCGTGCTTCATAGCGAACAAAGTAACATGGTGAATTTTAATAAT
AAATAGGTCACCTATAAAAATATCAATCACAATAATGAGAGCACAAGAAGTCTAATTAAA
AATCACTACAATAACAACATTCTAGCTGTAAATAATGCTTATTAAAATAATAACATAATC
TCTAATATGCATACAGCCAATTAGCTTAGTAATAATAATTTAATTAATAATCACAGTGAC
AACATTTTAGTTAAAAATTTAAGCGAATCTTCTTAAAACTAATCAAATAAAGCTCAAGAA
AACGATCATCCTTTGACTGTGTTCTAGAAAAATAAGCAATTTTACATTATTAAAAATGAG
ATTTCTGATCATCCTCAAATACATGCCAATAACCAACTTAATTTTATGGAAAATAACGAT
GAAGACGAAGAAAGAGCCTTTAGTTAAAATAGCTAGGCCGCAAGTGATAATAAGAAAAAA
GGCAGTCCATCTAGCGATTAAAATGATAAAGCGAAGTAGACTAGTGTCAATGCGTTTGTG
CAAGAAAACGAAGATTTTAATGACGATGAAATGAATGAATACAGCAACAGCATCAATAAA
ATAAACAAACTCCCAAAAGAGTAAAATAAAAAAATCAGTGTTTATGAAAAAGAGTCTCAA
CTCCAATCCAAAATCCACACGAATAAAGGAGTATTTGGAGAAGAACCTGACAGACCTTCC
CATCTAGGCGACAGCAAAAAAATATACATTGGAAATGACTAATTTGAAAGTGTAGCAGAA
ACTGTCCCCAAAACAAATGTCCTAATAAACAATGAAAACGAAACATCTCAATAACTTAAA
GAGTTGAATACATTCAATATCAACTACCAAAATACTAAAGTTAATATCATTTAATCTGAG
AAAAACTCAGAACTTCCCCCCGCAACCCGCTACGAAGGAGTTAAAATACCTCAAGCTGAC
TCTGACAACGAAATCGAATATCAAACCGATAACCTCGATATGTAAAAAATGGAAGAAATA
CAAAAATATATGTCTAAGAGCAAGTTCTCTTAGCTTCCATAATAATAAGAAGATAAACAC
TAAGACTGA


>TTHERM_01166280(protein)
MSHKVRDQEESNRQTIYLNDRTQNQLIHRKFYNHIKTSKYTWWNFVPKALILQFMRAANF
YFLISTVVQCIDIISPLAPFSAVGPLILVLAVSLSREAIEDYKRHRNDDLVNEQKSFIFN
NKNFTSIMWKDIQLGDIIKVNQEQILPADILVITTNEENGTGFVETANLDGERNLKSKIS
HEIVNKYGREHSLIKFKGKIVCDKPNNRIHSFKGLLYLDDESKPIVLNNNNVMLRGTTLK
NTEWVIGVVIYSGQDTKIMRNQGQVKHKSTHIEKKVNPIIFITLLVQLALCIIMAILLSI
FQKNTNPLENNKYNYAYLYGNSSDGLYSYEVQGTINFFSYFLLLNSLIPISLIISMEVVK
LFQSSFMEYDAEMHYLDDGQVQKMKVLNTMIHEELGKIDYIFTDKTGTLTCNIMIFRHAN
IAGSDYSEKELEDILAKLEYQTLTYDEEYKDFYQFWMCIAICHDVILEEKQNEINYQGSS
PDEVCLVEKAQKYNFKFLKRTTNQIFIQVGSEMHTFKLLNKIEFTSERKRMSVIIQDPIT
GKIYMYTKGADSFMLKHISNTSEALKSNIKQSLKYYSKHGLRTLCLGMKELNQQEYDAWN
SQIQDLNMNMIGDLFPEKTKDKIADLENEIETGFDLLGVTALEDKLQEGVPEVLKDFHEA
GINVWMLTGDKLETAENIGYLCNLLNNQTKVFRVQSHYPDVTRDKFFRIKGRINQIKTVS
EIGEIRIKNNQNNHHDFKNKKVGHQNQNINRIINDGGSQSRRDSYLTKEENNSFEINQVK
GYTGFALVIEGEAIGHALHDDQCRKEFLQIIPECCTVICCRSTPTQKAEMVKFVKTHFNK
TCLAVGDGGNDVTMIQEADIGVGIIGKEGNQAALSSDYYFGQFRFLWRLLFVHGRWNLYR
TSYFVNYFFLKNFIFTLQQFYFGFFCAYSGQSFWEDGYLLNFNSIITACAPVYFAGFEQD
VNPHGSEYIAKYLPRLYKIFREKDLFSFKVFGIVFLQGVGLSLTTYFSVFFINYQDYYQM
SGDGKIDGLWFQSFSSYCSTVGVVWAINFMDTTYFSPFTFFSYVIVSLFLFFPAFAFTYD
IFAGPLQEMLLINIGNWKFWLTLFLNVAFICIIKYTYKVYRYIFAPELVHDLQYHRKKLN
EAEKQVKNQQTDPNINNSNNAKNNNNNNNAYTTPENGLQIEIADNIQQNEIALQNPSKKS
VELEHKQEKASKRTASLQNVEHQQNLNVEFTDLKLQMNHDLDKGSGRKLNKPQSQNFITI
QNNDQSVLHSEQSNMVNFNNKQVTYKNINHNNESTRSLIKNHYNNNILAVNNAYQNNNII
SNMHTANQLSNNNLINNHSDNILVKNLSESSQNQSNKAQENDHPLTVFQKNKQFYIIKNE
ISDHPQIHANNQLNFMENNDEDEERAFSQNSQAASDNKKKGSPSSDQNDKAKQTSVNAFV
QENEDFNDDEMNEYSNSINKINKLPKEQNKKISVYEKESQLQSKIHTNKGVFGEEPDRPS
HLGDSKKIYIGNDQFESVAETVPKTNVLINNENETSQQLKELNTFNINYQNTKVNIIQSE
KNSELPPATRYEGVKIPQADSDNEIEYQTDNLDMQKMEEIQKYMSKSKFSQLPQQQEDKH
QD


>TTHERM_01166280(gene)
ATGTCGCACAAAGTGAGAGACTAAGAAGAATCTAACAGATAAACAATATATCTTAATGAT
CGTACATAAAATCAATTGATTCATAGAAAGTTTTACAATCATATAAAGACATCAAAATAC
ACATGGTGGAACTTTGTTCCAAAGGCGTTGATTTTGCAATTTATGAGAGCAGCTAATTTT
TATTTCTTAATTTCTACTGTTGTCCAATGTATAGATATCATTTCCCCTTTAGCGCCTTTT
TCCGCGGTTGGCCCACTCATATTAGTGCTTGCCGTATCTTTATCAAGAGAAGCAATTGAA
GATTATGTAATTAATCACTTATTTTTTCTATTATCAAGCAATATTAAAAGGCTAAGCATT
TATAAACAGCCTCAAAGCATTGCTGTTACCTTGAACTCAATAATTATTTTCAATTTCTAA
TAAAGAAAAGACACCGCAATGACGATCTTGTCAACGAATAGAAATCATTTATTTTTAATA
ACAAAAACTTTACAAGCATTATGTGGAAGGATATTTAGCTTGGCGATATTATAAAAGTTA
ACTAAGAGCAGGTAATTTGATACATAAATGTTAATATAATATTTTTGTAATCCATTTAGC
ACTCTTCTGAGTAGAGTTAGCTAGCTTTACTAATATTAAAATTCTTCTATTTCTATTTCA
TGATTCAATCAATCAATACAATACAATAAATATATCTTGAATTTAGATAGAATTCTTTTA
GTTTAGTTTTACTATCAAAAAATGAATACAAATTAATAAAAACTTTCAAGCTAATTCTCA
TGCATTTTTAAATTAAATTTAAAGATATTGCCAGCAGATATTTTGGTTATTACAACAAAT
GAAGAAAACGGCACAGGTTTTGTCGAAACTGCTAACTTGGATGGGTAAATTATGCTAAAA
AATTTAATGTTTATGCATTTAATAGAATTTTTATGTTAGAATCTAAATTTTTGCCAACTT
TATTTGAAATTGATTTGATTTGATTTGATTTATTTATTTATGAAATTGAATTATAATCTT
CTATTTCACTTATCAATCAATAGTGAGAGAAACCTAAAAAGCAAAATATCTCATGAGATT
GTAAACAAGTACGGTAGAGAACATTCTCTCATTAAATTCAAGGGAAAAATTGTTTGTGAT
AAACCTAACAACAGAATCCATAGTTTCAAAGGTTTGCTCTATTTGGACGACGAATCGAAA
CCAATAGTACTCAACAATAATAATGTCATGCTCAGAGTAACAAAAAACTTTTTCACATAT
TTTAAAAAATTTAAGTTGAAAAAAAGAATAAAATTAGCAAGTTTTAAAAAAATTATAGAC
TCAAATATCATAAGCGATTTATCATAGTTTATTTCTGAATAAGCCAAATAAAAATAATAA
AAATCAATCCAATTATTGAATGAAAAAATATTCCAACAAACAATAGTGGCTTATTTAGTT
TGCTTAGTATTTTATCAAAGAAATAAATCTTAAAATTATAAAAATGCTATTAATTAATTC
ATATAGAAATTAAGAAATTTACCTTTTAATTATTATTATTAATATAAATAATAAAACGTA
TTAACTAACAGTTAGATAATCAAAGAATTTAAATTATTTAGATATTTTCAAGCTTTATAA
AATACTAAGCTATTTCCAAAAAGCGTTTTATCAAATAAATAAATAAATAAATGATTAATT
AATTGATTTAGAAATCATGAAAATTGAGTAATTATAAGCGTAAATTAAAATCAATAAATA
TATTAAGAAAGGAATTAGCTTGCTTAGATATTTTCAAGCTGTACATTTACTTACTTAGCT
ATTTCCAACTAGTGTTTATTGAAAAAAAAGCATTAAAAAATAAATAATTTATCGTTCTTT
TAGAATTGGTGAAACTTTACTTTTTATTAGCATAAATAATTATAGATAGATTATGAAAGA
ATTTAAATTTTTAAATACTTTTAAGCTATATAATTTACTTAGCTATTTCCAAAAAAGTGT
TTTCAGAAAAAAAATATTAAAACATGAAAATATTAATTGATTAATTGAAAAATCATGCAA
TTTTAGTAATTATTAAAATAAATAATAACACTTATCAATAGATAGATTATGAAAGAATTT
ACTTGTTAAGATATTTTCAAGCTTTTTAATTTACTTAGCTATTTCCAAAAAAGTGTTTTC
AGAAAAAAAATTATTAATTGATTAATTGAAAAATCATGCAATTTTAGTAATTATTAAAAC
AAATAATAACACTTATCAATAGATAGATTATGAAAGAATTTACTTATTAAGATATTTTCA
AGCTTTTTAATTTATTTAGCTATTTCCAAAAAGTCTTTTATGAAAATAATACTAAAACAA
GAAATATTAGAAATTGTGTAATTTTAGTAATTATTATTAGTATAAATAAATACATAATAA
CTCAAATAACAATCAACATACTATGAATGAATAAGCTTATTTTGATATTTAAAGCTATAA
ATTTTACTATTTTTTCCTATGTGTTGTTTTTTGAAAGAAACAATTTTTAAAATTTAACTA
ATGAATTTAGAATTTTTTAACAAATAAATTCTTAGTAGCAAAGTTTTCATTAGATTTTTG
GAAAAAATTAGCTTTTTCAAATCTTTTAAAGCTAGCTAGATATTTAGCAATTCCAAAAAA
TGTTTTTTGAACGAATTAACTCTTAAAATTAACAAAATATTATGAAACAAAATAGCATTT
TAGTAATTAATAATTAACTAGGCTTATGAAAAAACTATGAAAGAATTAACTTATTTTAAT
ATTTTTAAGCAATTTAATTTACTTGGTTATTTAAAAAAACATTTTATTTATTTTAAAGAT
TTATAATTTATTCAGATGGAATAATAACTGTTTTTAATAATTACTAATAGGGCACAACTT
TAAAGAATACTGAATGGGTGATAGGAGTGGTAATTTATTCAGGTCAAGACACGAAAATAA
TGAGGAACTAAGGGTATTTTTAAGTATTTTAATTAGGTTTTTTAAAATATATTTTAAATG
AATTAGGCAAGTGAAGCACAAATCTACTCATATAGAAAAGAAAGTGAATCCTATAATTTT
TATAACATTGTTAGTTCAATTAGCTCTATGCATTATTATGGCTATTCTTCTATCTATTTT
TTAGGTAGACTTTAATTTGCCTTTAGATATTTAAGCTTTTAATATATATTTTTTTTTAAA
ATTATTATGAAGAAAAACACAAATCCTTTGGAAAATAATAAATATAACTACGCTTATCTT
TATGGAAACAGTAGCGATGGTCTTTATAGCTATGAAGTTTAGGGAACAATCAATTTTTTT
TCATACTTTTTACTATTAAATTCACTTATTCCTATTTCTTTGATTATTTCTATGGAAGTT
GTCAAACTATTTTAATCATCTTTCATGGAGTATGATGCTGAAATGCACTATTTAGACGAT
GGATAAGTTCAAAAAATGAAGGTGCTCAATACTATGATTCATGAAGAGTTAGGAAAAATT
GATTACATCTTTACAGATAAAGTAACTTCTTTATATTTTCAACATATTTTATATTTGGTT
AAATACTAACAAATAAATAGACAGGAACATTGACTTGCAACATTATGATTTTCAGACATG
CAAATATCGCTGGTTCTGACTACTCTGAAAAAGAACTTGAAGACATCTTAGCAAAATTAG
AGTATCAAACTCTCACTTACGATGAAGAATACAAAGATTTTTATCAATTTTGGATGTGCA
TTGCTATTTGTCACGACGTTATCCTTGAGGAAAAACAAAACGAAATTAATTATTAAGGTT
CATCACCAGATGAAGTATGTCTCGTAGAAAAAGCTCAAAAATATAATTTCAAATTTCTCA
AAAGAACAACAAATTAAATATTTATACAAGTGGGATCAGAAATGCATACATTTAAGCTTC
TCAATAAAATAGAATTCACAAGTGAGCGTAAAAGAATGAGTGTCATTATTTAGGTATTCA
AATTCATTCTAAATATTAAAAAATTAATTAATTCTTTTATAATCCAACAAATAATTAATA
AAATTTATTAAATTTTATGAAATTTGCTTTAAAAATTATGAAAAAAATTAAAGTTTTGTT
TCTTAAATGAAGGAATTTTGTGCTTTTTTTAGAACCAAATAAAAATTGAAATGGTTTTTG
ATAATGAAAGAAAGACAATTTTTTGCTTGAATTATCCTAAAAATAATTATTGAAAAAATA
AATTTGTTTTTGTAAAAAAAAAGGATCCAATAACAGGAAAAATATATATGTACACTAAGG
GAGCTGATTCGTTCATGCTCAAACATATTTCGAATACAAGTGAAGCACTTAAAAGTAATA
TAAAGCAAAGCCTCAAATACTATTCAAAGCACGTAAGTAAACAGATTGAAAGACAATGTT
TTAAATGAAAATATTTAAAAAAGGGGTTAAGAACTCTCTGCTTGGGTATGAAAGAGTTAA
ATCAATAAGAATATGATGCATGGAATTCGCAAATACAGGATTTAAATATGAACATGATTG
GAGACTTGTTCCCTGAAAAAACTAAAGATAAAATTGCTGATGTAAGATAAATTAAATGAA
ATTTTCATTTGGTTTTACTATAAAAATTTGATTTTATTTTAAAATTGATAAAAGCTTGAA
AATGAGATAGAAACAGGCTTTGATCTTTTGGGAGTTACTGCACTTGAAGATAAATTGCAA
GAAGGAGTTCCTGAAGTTTTAAAGGATTTCCATGAAGCTGGAATCAATGTTTGGATGCTC
ACAGGTGACAAACTTGAAACAGCAGAAAATATTGGTTATCTTTGCAACTTGCTGAACAAT
CAAACTAAAGTGTTCAGAGTTCAATCTCACTATCCAGACGTTACGAGGTGAATAAATATT
TCAAGAATAACCAACTAATTAATTAATAGTGATAATTTTGTTTAAATAAATAAATAGAGA
CAAGTTCTTTAGAATAAAGGGAAGAATCAACCAAATAAAAACTGTCAGCGAAATAGGAGA
AATAAGAATAAAAAACAACTAAAATAACCACCATGATTTCAAAAACAAAAAAGTTGGACA
TTAAAACCAGAATATAAACAGAATAATAAACGATGGAGGTTCCTAATCGAGACGAGATTC
CTATCTAACTAAAGAAGAAAATAATTCATTTGAAATAAACTAAGTGAAAGGCTACACAGG
ATTTGCCTTGGTAATAGAAGGAGAAGCAATCGGTCATGCCTTACATGATGATTAATGTAG
AAAAGAGTTCTTGCAAATCATTCCAGAATGCTGCACTGTTATATGCTGCAGATCAACTCC
AACATAAAAAGCAGAAATGGTCAAATTCGTTAAAACTCATTTTAATAAAACTTGTCTAGC
TGTCGGAGATGGAGGTAATGACGTAACCATGATCTAAGAAGCAGATATCGGAGTTGGTAA
AAACTAAATTAATAAATTTATTCTTAAAATAAAAACCAAAGCAAAAAAGCATATTTATTA
TTCTAACTTAGTGAATTTTACTAAAACAGAAATTTAATGACAAATAAACAAATAAATGAA
TGAAAGAATAAAAACAATTAACATAAAATTCAATTAAAAGACAAACATTCATAAAATTAA
TGAATTTCTGATAAAAAAAATTATTTTATTTTTCAAATAGATTTTAAATAAATTAAATAA
TTTCATTATAAATTAGCTTCGATTATTCATTTTAAAAATCAAATAAATGAAAAACCTTTA
AAAATTATTGTTTTTTGCTAAAAATATGAACGGCTTTTAAAATAAAATCTAAGGGATTCT
TTCATGAAAAACAATTAATTAATTTGAATAAGAAATCTAAATTTTTACATGAATATTAAT
TGTTAATGACTTAGCAATTGTTAATTATTTATTATAAAAATGAACCAAAAAATCATTCAA
GGAAATACCTTTAAAAAAATAATTATTTTTTGCTAATTATTTAAATAGATTTTTAAAATA
AATAATAGATAATACAAATTTATTTTGAGATTAATAAACAATTTATGAATTTAATAAAGT
ATCGAAATTGAATTCACTTAATTAATATTTTTGTTTTTTTTTAGGTATTATTGGTAAGGA
AGGAAATCAAGCAGCTTTAAGCAGCGATTATTACTTTGGGTAGTTTAGGTTTTTGTGGAG
ACTTTTGTTTGTTCATGGGAGATGGAATTTATACAGAACATCTTACTTTGTTAACTATTT
CTTCCTTAAAAATTTTATTTTCACACTTCAATAGTTCTACTTTGGGTTCTTTTGTGCTTA
TTCAGGGTAGTCTTTTTGGGAAGACGGTTATTTACTCAATTTCAACTCTATTATTACTGC
TTGTGCTCCAGTTTATTTTGCAGGGTTTGAGTAAGATGTCAATCCTCATGGATCTGAGTA
CATCGCTAAGTATTTGCCTCGTCTCTACAAAATATTTAGAGAAAAAGATCTTTTTTCTTT
TAAGGTCTTCGGAATAGTTTTCTTATAAGGTGTTGGCCTTTCTCTTACAACTTATTTTTC
TGTATTTTTTATCAACTATTAGGTAATACAATATTTAATTTCTTTGAATGAAGTAAATAT
TTTTAACATAAATAAATTTAGGATTACTATTAGATGAGCGGAGATGGTAAAATCGATGGT
TTGTGGTTTTAAAGCTTTTCTTCTTACTGCAGCACAGTTGGAGTGGTTTGGGCTATCAAT
TTTATGGACACAACATATTTTTCACCATTTACTTTCTTTTCTTACGTGATTGTTAGTTTG
TTCTTATTCTTCCCTGCTTTCGCTTTTACTTATGACATTTTTGCTGGTCCCTTGCAAGAA
ATGTTACTTATAAACATTGGAAATTGGAAATTCTGGTTGACTTTGTTCTTAAATGTTGCT
TTTATCTGTATTATTAAATACACATATAAAGTTTACAGATACATATTTGCTCCAGAATTA
GTTCATGATTTGCAATATCACAGAAAGAAGTTAAACGAAGCTGAGAAGTAAGTTAAAAAT
CAATAAACTGATCCTAATATTAATAATAGCAATAATGCTAAAAATAACAACAACAATAAT
AATGCCTACACTACTCCTGAAAATGGTTTACAAATCGAAATTGCAGATAATATCCAATAA
AATGAAATTGCACTCTAAAATCCATCTAAAAAATCTGTAGAATTAGAACATAAATAAGAA
AAGGCTTCAAAGAGGACTGCGTCTTTATAAAATGTGGAACACTAACAAAATTTAAATGTC
GAATTTACTGATTTAAAACTTTAAATGAATCATGATCTAGATAAAGGCAGTGGAAGAAAA
TTAAATAAACCTCAAAGCTAAAATTTCATCACTATTTAAAATAATGATTAGAGCGTGCTT
CATAGCGAACAAAGTAACATGGTGAATTTTAATAATAAATAGGTCACCTATAAAAATATC
AATCACAATAATGAGAGCACAAGAAGTCTAATTAAAAATCACTACAATAACAACATTCTA
GCTGTAAATAATGCTTATTAAAATAATAACATAATCTCTAATATGCATACAGCCAATTAG
CTTAGTAATAATAATTTAATTAATAATCACAGTGACAACATTTTAGTTAAAAATTTAAGC
GAATCTTCTTAAAACTAATCAAATAAAGCTCAAGAAAACGATCATCCTTTGACTGTGTTC
TAGAAAAATAAGCAATTTTACATTATTAAAAATGAGATTTCTGATCATCCTCAAATACAT
GCCAATAACCAACTTAATTTTATGGAAAATAACGATGAAGACGAAGAAAGAGCCTTTAGT
TAAAATAGCTAGGCCGCAAGTGATAATAAGAAAAAAGGCAGTCCATCTAGCGATTAAAAT
GATAAAGCGAAGTAGACTAGTGTCAATGCGTTTGTGCAAGAAAACGAAGATTTTAATGAC
GATGAAATGAATGAATACAGCAACAGCATCAATAAAATAAACAAACTCCCAAAAGAGTAA
AATAAAAAAATCAGTGTTTATGAAAAAGAGTCTCAACTCCAATCCAAAATCCACACGAAT
AAAGGAGTATTTGGAGAAGAACCTGACAGACCTTCCCATCTAGGCGACAGCAAAAAAATA
TACATTGGAAATGACTAATTTGAAAGTGTAGCAGAAACTGTCCCCAAAACAAATGTCCTA
ATAAACAATGAAAACGAAACATCTCAATAACTTAAAGAGTTGAATACATTCAATATCAAC
TACCAAAATACTAAAGTTAATATCATTTAATCTGAGAAAAACTCAGAACTTCCCCCCGCA
ACCCGCTACGAAGGAGTTAAAATACCTCAAGCTGACTCTGACAACGAAATCGAATATCAA
ACCGATAACCTCGATATGTAAAAAATGGAAGAAATACAAAAATATATGTCTAAGAGCAAG
TTCTCTTAGCTTCCATAATAATAAGAAGATAAACACTAAGACTGA