Identifiers and Description

Gene Model Identifier

TTHERM_00600310

Standard Name

FLP14 (FLiPpase)

Aliases

PreTt22094 | 83.m00163 | 3685.m00055

Description

phospholipid-translocating P-type ATPase, flippase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR00099 ) Cof-like hydrolase
  • ( TIGR01487 ) SPP-like hydrolase, Archaeal
  • ( TIGR00338 ) phosphoserine phosphatase SerB
  • ( PF00702 ) haloacid dehalogenase-like hydrolase
  • ( PF08282 ) haloacid dehalogenase-like hydrolase
  • ( TIGR01517 ) calcium-translocating P-type ATPase, PMCA-type
  • ( TIGR01116 ) calcium-translocating P-type ATPase, SERCA-type
  • ( TIGR01652 ) phospholipid-translocating P-type ATPase, flippase
  • ( TIGR01494 ) ATPase, P-type (transporting), HAD superfamily,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00600310

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_216840
Tetrahymena borealisEI9_14898.19.997093137033517e-262phospholipid-translocating P-t
ype ATPase, flippase (912 aa)
OxytrichaContig11192.0.g819.997093137033517e-262haloacid dehalogenase-like hyd
rolase
DictyBaseDDB_G02693803.999622461503957e-161DDB_G0269380 on chromosome: 1
position 2645714 to 2650717
SGDYAL026C6.002069467939404e-154DRS2 Aminophospholipid translo
case (flippase) that maintains
membrane lipid asymmetry in p
ost-Golgi secretory vesicles;
contributes to clathrin-coated
vesicle formation and endocyt
osis; mutations in human homol
og ATP8B1 result in liver dise
ase
WormBaseWBGene000130349.995938456217754e-149locus:tat-1 status:Partially
_confirmed UniProt:Q9U280
protein_id:CAE54923.1

General Information

Paragraph NoGene NameParagraph Text
19FLP11,
FLP18,
FLP17,
FLP8,
FLP16,
FLP15,
FLP14,
FLP6,
FLP13,
FLP10,
FLP2,
FLP1,
DNF1 ,
FLP9,
FLP12,
FLP4,
FLP7,
FLP5,
FLP19
The phospholipid flippase family of genes in Tetrahymena contains 20 members, FLP1-FLP20. Preliminary studies show that many of these genes are differentially regulated in response to temperature and/or the presence of a polycyclic aromatic hydrocarbon (pyrene).

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00600310(coding)
ATGCAATAAGACATGCAAAACACGGACAATATTGTTGATGAAATTTAAAAATCCTACCAA
AATTAAATAGAAGAATCTTATTTTTTTTGCTTAAGGAGATAGAAAGTTAGAGATCAAGAT
AAAAGAGCTATCTACTTAGGAGTTCCAGATAATTAAGTTTGTGATAATAGAATTTAAACA
TCAAAATACAATTATATTACATTTATACCTAAAAATTTACTTGTATAGTTTAGCAAACTT
GCAAATATCTACTTTTTAATTATTGGAATATTTTAAATACTTCCTTCAATTACAACGACT
GAGGGAAAGCCTATTGTTTATACACCTTTAACAATTATAGTTGTTATTAGTATGATAAAG
GATTTTATTGAGGATAGAAAAAGGAGAAAATAAGATTAGTTTGAAAATCAGTCTGATACT
AAGAAGCTCAATGTAAAAACAGGCTAATTTGAGAAAGTAAAATGGTAAGATCTAAGGATA
GGCGATATAATATAAGTAAATTTAAATGAGAGATTTCCAGCAGATATTTTGGTGTTATCT
AGTACTAATCAATATGGAATTTGTTACATAGAAACAAAAAACTTAGACGGTGAAGTCAAT
TTAAAGCAAAGATAGAGTTGTGCTCCTAATTTATTTCAAGATGAATAGTTTACATAAAAT
ATAAATAATATTGGAAGATTTTAATTCATATATGAAGACCCTAATATTCGTATTCACAGT
TTTAATGGAATAATGATTGACAAGCAGGATACAGACAGTTAATAAAATCAGTATCTTCTA
TCTTTATAAAACATTTGCTTAAGAGGTTGTACTCTCAAGCGTACTAAATCTCTAATTGGG
ATTGTTATTTATTCTGGACATGATTGCAAATCTCTAAAATATGCAAATAGAGGACAGTAC
AAGTTTGGCACAGTTGAAAAATTAATGAATAAGATGGTGCTTTATGTATTTATTATATTG
GTTTTAATAAGTATTTTCTGTGCATCATACTACACTATTTGGTACAAATAGAAAAAAGAT
GAGCTTCCATATTTAGTTATCGGAAAAAGTGATATAGAATCTCACCTAGTCGTTAGCTTT
TTTATTAGAATTCCAATGTGGATTTTATTACTTAATCCCTTTGTTCCTATATCTTTAATG
GTAACACTTGAAATTGTAAAATACCTTTAAGGCTAGTTGCTGAGTAAAGACAAAAATTTT
GTGAACAGCATTAGTGATGAATTAGTAGAAGTAAATGGTAGTAATTTAATAGATTAGCTT
GGACAAGTAAAGTACATTCTAACTGACAAAACAGGGACTCTAACAGCTAATATTATGAAA
TTTAAGGCTCTATCATTAAACAGTGTTTGTTATGAATATAATTATTAACAAGATGATCAT
GGAATTTTAATGAGCTAGAAACTTATTGATCTTTTAAAAAATGCTTAAGAGAATTAAATA
GAGTACGAAGCACTTATGTGTATGAATTTATGCCATGAGCTGTTAATAGAATAATAAGAG
GGAAAAAGATTGTATCTTGGAACAAGTCCTGATGAAGAATGCATCATGGACTTTTGTGTT
TAAACAGGTATTTATTTAGAGAGCGTAGACGAGCATAAAGTGATGACTATTTATGATTCT
ATCAACGATAAGAGGCTTTAATTTAAGATAATAGCCTTGCATGAATATCGTTCGGATATT
AGAAAAATGTCGATTTTGGTTTAAAATTTATAGACAAAATAATATAAAATTTACTAGAAA
GGAGCTATGAACACAATATTTCAATGCTGTAGATAAGATTAAAAAAATAAAATGATAGCT
GTTGAAGAGCATTTAAATAATTTCGCTAGCAACATGCTTAGGACTCTTTGTCTCTCATAT
AGAAACTTGAGTGAAAATGAAATCACAAAATTCTTTGATAAGAGGAGCAAAGATCTAGAA
GGTGGAAATTTAAATATTCAAGAAATGAATGATGGTCTGTTTGCAGAAATCGAAAATGAA
CAAATTTTGATAGGCGGTACCGGAGTTAATGATGAATTTGCAGACTAAGTTGTTCAAACT
CTTTCTAATTTAAAGTAAGCTGGAATTAAAATTTGGATGATTACTGGAGATAAAAGAGAA
ACAGCTTTGAGTATTGGTATCAAATCAAATATAGTAGAGTAAGGTGTTGAATTAAAAGTT
ATTTAAGATGCTACTGAAAGCATCATTAATGAATAATTAGTAATTAATGAGCTTAAGATG
TTCGAAGATTAATTAAAGTAATAATAAAAGTTAAGCATAGGTATCTCTGGATTAACTTTT
TATGGAATTAATATATCAACAAATACTGAAATAAAACAAACATTTAGCTACATAATGAAG
CATGCTGATTCAGTCATAGCATATCATTTCACTCCCAATTAAAAAAAATAACTTGTAGAT
TTAGTTCATAACATAAGTCCAGGTCAATGTGTATTAGCAATAGGAGATGGAGCTAATGAT
ATTAATATGTTATAGGTTGCTGATGTCGGCATAGGAATACGTGGAAAAGAAGGTAGAGAG
GCAGCAAAAGCTTCAGATTTTTCAATTGCAGAATTTAAACATTTAAACAGGCTAATACTT
TATGTAGGATAAGAGGCTTATAGAAAAAACAGTCATCTAATTTTATTCAATTTTTATAAA
AATCAAGCTTGGATACTTGTTTATTTTTGGATCAATTTTTATTCTGGTTAAAGTGGTTAG
TATGTTTACGATTAATGGATTTCTCAATTTTTCAATTTATTCTACTCATCTCTTCCTATC
ATAATTTATGCTTTGTTTGATGAAATCCACCCTTCAAATTAATTCTTTAAAGCTATACAA
ACTGATAAAAATATTTTAGAATCAAGACCTCAAGATTACAAAAAATTTACCAACAATCTC
ATATTTTAACAAAAAAATTTTTGGAAATGGTTTTTCTATGGTTCTTTCCATGCACTGATA
ATAACTTTTATCTCATTTTTCAGTGTTGGGGATAATTCTGATTAACATGGAAGATAAACG
GATATATTTTATTAAGGAATGCTTGCATTTACTTGTTGTGTTATAGTTACAAATTTAAAG
GTGTAATAATTGCACTAAACTCACTGTTTTTTGAACATATTTTTTATATATGCGAGTATT
GCTTTTTATCTATTAAACCTATTTATTGCTAGTAAGATAATTAAAATAGAAATATACGAA
GTTTATTCACGCTTATTCTGCTAACCAAATACTTACCTTGCTATAGCTTTATCAATAATG
ACTGCATATGGGGCTGATTCTGCATATTAAGTTTTTAAATAACTTAATATCCCAGAAAAA
GCTTAAATTTAGGAGCCATTAAAAAGCAAGTAAAGTATTAGATTTAGTTAAGAAGAAAAA
GTGGTATGCTAGGAAATAGATATTGAAGATATGATAAAAAACTATCCAGAAAATCGCTAT
AGTAGTGGCTTGCATGAAAAGCTTATTTCAAAATAACAACAACAATTAAAAGATTTAAGA
ATAAGTAATTAATCTAGTGCTAGTATAAATAAGGCTTATGAAGAGCCATATGAAAACGAT
ATTGGTTTTTAAAATTTATTATAAAATTAAAATTCATATGCTTAATCATCAATCAGATAT
TCGAATATCCCATCCATTAAGATATAAAGAGTGGATACATTATGA


>TTHERM_00600310(protein)
MQQDMQNTDNIVDEIQKSYQNQIEESYFFCLRRQKVRDQDKRAIYLGVPDNQVCDNRIQT
SKYNYITFIPKNLLVQFSKLANIYFLIIGIFQILPSITTTEGKPIVYTPLTIIVVISMIK
DFIEDRKRRKQDQFENQSDTKKLNVKTGQFEKVKWQDLRIGDIIQVNLNERFPADILVLS
STNQYGICYIETKNLDGEVNLKQRQSCAPNLFQDEQFTQNINNIGRFQFIYEDPNIRIHS
FNGIMIDKQDTDSQQNQYLLSLQNICLRGCTLKRTKSLIGIVIYSGHDCKSLKYANRGQY
KFGTVEKLMNKMVLYVFIILVLISIFCASYYTIWYKQKKDELPYLVIGKSDIESHLVVSF
FIRIPMWILLLNPFVPISLMVTLEIVKYLQGQLLSKDKNFVNSISDELVEVNGSNLIDQL
GQVKYILTDKTGTLTANIMKFKALSLNSVCYEYNYQQDDHGILMSQKLIDLLKNAQENQI
EYEALMCMNLCHELLIEQQEGKRLYLGTSPDEECIMDFCVQTGIYLESVDEHKVMTIYDS
INDKRLQFKIIALHEYRSDIRKMSILVQNLQTKQYKIYQKGAMNTIFQCCRQDQKNKMIA
VEEHLNNFASNMLRTLCLSYRNLSENEITKFFDKRSKDLEGGNLNIQEMNDGLFAEIENE
QILIGGTGVNDEFADQVVQTLSNLKQAGIKIWMITGDKRETALSIGIKSNIVEQGVELKV
IQDATESIINEQLVINELKMFEDQLKQQQKLSIGISGLTFYGINISTNTEIKQTFSYIMK
HADSVIAYHFTPNQKKQLVDLVHNISPGQCVLAIGDGANDINMLQVADVGIGIRGKEGRE
AAKASDFSIAEFKHLNRLILYVGQEAYRKNSHLILFNFYKNQAWILVYFWINFYSGQSGQ
YVYDQWISQFFNLFYSSLPIIIYALFDEIHPSNQFFKAIQTDKNILESRPQDYKKFTNNL
IFQQKNFWKWFFYGSFHALIITFISFFSVGDNSDQHGRQTDIFYQGMLAFTCCVIVTNLK
VQQLHQTHCFLNIFFIYASIAFYLLNLFIASKIIKIEIYEVYSRLFCQPNTYLAIALSIM
TAYGADSAYQVFKQLNIPEKAQIQEPLKSKQSIRFSQEEKVVCQEIDIEDMIKNYPENRY
SSGLHEKLISKQQQQLKDLRISNQSSASINKAYEEPYENDIGFQNLLQNQNSYAQSSIRY
SNIPSIKIQRVDTL


>TTHERM_00600310(gene)
ATGCAATAAGACATGCAAAACACGGACAATATTGTTGATGAAATTTAAAAATCCTACCAA
AATTAAATAGAAGAATCTTATTTTTTTTGCTTAAGGAGATAGAAAGTTAGAGATCAAGAT
AAAAGAGCTATCTACTTAGGAGTTCCAGATAATTAAGTTTGTGATAATAGAATTTAAACA
TCAAAATACAATTATATTACATTTATACCTAAAAATTTACTTGTATAGTTTAGCAAACTT
GCAAATATCTACTTTTTAATTATTGGAATATTTTAAATACTTCCTTCAATTACAACGACT
GAGGGAAAGCCTATTGTTTATACACCTTTAACAATTATAGTTGTTATTAGTATGATAAAG
GATTTTATTGAGGATAGAAAAAGGAGAAAATAAGATTAGTTTGAAAATCAGTCTGATACT
AAGAAGCTCAATGTAAAAACAGGCTAATTTGAGAAAGTAAAATGGTAAGATCTAAGGATA
GGCGATATAATATAAGTAAATTTAAATGAGAGATTTCCAGCAGATATTTTGGTGTTATCT
AGTACTAATCAATATGTAATTTCTTTATAGACTTATTAATTAAAAAGTTAATCAAATTAT
TAGTGATTATCATGTGTAAAAGCATTGATTTTTTTATTTAATTATTTTGTAAACTGGATA
AAAATCTTATAAAATCTTATAATCCATTTATTTTCTTTTATTATTTATAAAGGGAATTTG
TTACATAGAAACAAAAAACTTAGACGGTGAAGTCAATTTAAAGCAAAGATAGAGTTGTGC
TCCTAATTTATTTCAAGATGAATAGTTTACATAAAATATAAATAATATTGGAAGATTTTA
ATTCATATATGAAGACCCTAATATTCGTATTCACAGTTTTAATGGAATAATGATTGACAA
GCAGGATACAGACAGTTAATAAAATCAGTATCTTCTATCTTTATAAAACATTTGCTTAAG
AGGTTGTACTCTCAAGCGTACTAAATCTCTAATTGGGATTGTTATTTATTCTGGACATGA
TTGCAAATCTCTAAAATATGCAAATAGAGGACAGTAAAATTAAAATTTATTTATTTATTT
ATTAAAATAAAAATAAAAAATATTTATTTTCATAGGTACAAGTTTGGCACAGTTGAAAAA
TTAATGAATAAGATGGTGCTTTATGTATTTATTATATTGGTTTTAATAAGTATTTTCTGT
GCATCATACTACACTATTTGGTACAAATAGAAAAAAGATGAGCTTCCATATTTAGTTATC
GGAAAAAGTGATATAGAATCTCACCTAGTCGTTAGCTTTTTTATTAGAATTCCAATGTGG
ATTTTATTACTTAATCCCTTTGTTCCTATATCTTTAATGGTAACACTTGAAATTGTAAAA
TACCTTTAAGGCTAGTTGCTGAGTAAAGACAAAAATTTTGTGAACAGCATTAGTGATGAA
TTAGTAGAAGTAAATGGTAGTAATTTAATAGATTAGCTTGGACAAGTAAAGTACATTCTA
ACTGACAAAACAGGGACTCTAACAGCTAATATTATGAAATTTAAGGCTCTATCATTAAAC
AGTGTTTGTTATGAATATAATTATTAACAAGATGATCATGGAATTTTAATGAGCTAGAAA
CTTATTGATCTTTTAAAAAATGCTTAAGAGAATTAAGTATTTTATTAATTATGATTTATC
ACTGAAATGCATATTTTATTTATTTATTATTAAATTTTAGATAGAGTACGAAGCACTTAT
GTGTATGAATTTATGCCATGAGCTGTTAATAGAATAATAAGAGGGAAAAAGATTGTATCT
TGGAACAAGTCCTGATGAAGAATGCATCATGGACTTTTGTGTTTAAACAGGTATTTATTT
AGAGAGCGTAGACGAGCATAAAGTGATGACTATTTATGATTCTATCAACGATAAGAGGCT
TTAATTTAAGATAATAGCCTTGCATGAATATCGTTCGGATATTAGAAAAATGTCGATTTT
GGTTTAAAATTTATAGACAAAATAATATAAAATTTACTAGAAAGGAGCTATGAACACAAT
ATTTCAATGCTGTAGATAAGATTAAAAAAATAAAATGATAGCTGTTGAAGAGCATTTAAA
TAATTTCGCTAGCAACATGCTTAGGACTCTTTGTCTCTCATATAGAAACTTGAGTGAAAA
TGAAATCACAAAATTCTTTGATAAGTATTTATCTATTAATAGCTATAAAGCAAATCATTT
ATTTTTAAAAATATTTAAGGAGGAGCAAAGATCTAGAAGGTGGAAATTTAAATATTCAAG
AAATGAATGATGGTCTGTTTGCAGAAATCGAAAATGAACAAATTTTGATAGGCGGTACCG
GAGTTAATGATGAATTTGCAGACTAAGTTGTTCAAACTCTTTCTAATTTAAAGTAAGCTG
GAATTAAAATTTGGATGATTACTGGAGATAAAAGAGAAACAGCTTTGAGTATTGGTATCA
AATCAAATATAGTAGAGTAAGGTGTTGAATTAAAAGTTATTTAAGATGCTACTGAAAGCA
TCATTAATGAATAATTAGTAATTAATGAGCTTAAGATGTTCGAAGATTAATTAAAGTAAT
AATAAAAGTTAAGCATAGGTATCTCTGGATTAACTTTTTATGGAATTAATATATCAACAA
ATACTGAAATAAAACAAACATTTAGCTACATAATGAAGCATGCTGATTCAGTCATAGCAT
ATCATTTCACTCCCAATTAAAAAAAATAACTTGTAGATTTAGTTCATAACATAAGTCCAG
GTCAATGTGTATTAGCAATAGGAGATGGAGCTAATGATATTAATATGTTATAGGTTGCTG
ATGTCGGCATAGGAATACGTGGAAAAGAAGTAATTTTAATAGTAAAAAGCAACTATTTAA
TTAGTATTTTATAAAAATAAATTAGGGTAGAGAGGCAGCAAAAGCTTCAGATTTTTCAAT
TGCAGAATTTAAACATTTAAACAGGCTAATACTTTATGTAGGATAAGAGGCTTATAGAAA
AAACAGTCATCTAATTTTATTCAATTTTTATAAAAATCAAGCTTGGATACTTGTTTATTT
TTGGATCAATTTTTATTCTGGTTAAAGTGGTTAGTATGTTTACGATTAATGGATTTCTCA
ATTTTTCAATTTATTCTACTCATCTCTTCCTATCATAATTTATGCTTTGTTTGATGAAAT
CCACCCTTCAAATTAATTCTTTAAAGCTATACAAACTGATAAAAATATTTTAGAATCAAG
ACCTCAAGATTACAAAAAATTTACCAACAATCTCATATTTTAACAAAAAAATTTTTGGAA
ATGGTTTTTCTATGGTTCTTTCCATGCACTGATAATAACTTTTATCTCGTAAAACAATCA
ATTCTATTGATTTTATTTATTTAGTTACAAAAAATTAATTTAGTATTAGAAAAAAAATAT
AGTAAATTAAATTTTTCTACAAAATTTTTTAGTTTTTAAATTCATAATTATAATTTAATT
TAAAAAAATATTTAGATTTTTCAGTGTTGGGGATAATTCTGATTAACATGGAAGATAAAC
GGATATATTTTATTAAGGAATGCTTGCATTTACTTGTTGTGTTATAGTTACAAATTTAAA
GGTGTAATAATTGCACTAAACTCACTGTTTTTTGAACATATTTTTTATATATGCGAGTAT
TGCTTTTTATCTATTAAACCTATTTATTGCTAGTAAGATAATTAAAATAGAAATATACGA
AGTTTATTCACGCTTATTCTGCTAACCAAATACTTACCTTGCTATAGCTTTATCAATAAT
GACTGCATATGGGGCTGATTCTGCATATTAAGTTTTTAAATAACTTAATATCCCAGAAAA
AGCTTAAATTTAGGAGCCATTAAAAAGCAAGTAAAGTATTAGATTTAGTTAAGAAGAAAA
AGTGGTATGCTAGGAAATAGATATTGAAGATATGATAAAAAACTATCCAGAAAATCGCTA
TAGTAGTGGCTTGCATGAAAAGCTTATTTCAAAATAACAACAACAATTAAAAGATTTAAG
AATAAGTAATTAATCTAGTGCTAGTATAAATAAGGCTTATGAAGAGCCATATGAAAACGA
TATTGGTTTTTAAAATTTATTATAAAATTAAAATTCATATGCTTAATCATCAATCAGATA
TTCGAATATCCCATCCATTAAGATATAAAGAGTGGATACATTATGA