Identifiers and Description

Gene Model Identifier

TTHERM_00123720

Standard Name

FLP13 (FLiPpase)

Aliases

PreTt27286 | 8.m00546 | 3812.m02574

Description

phospholipid-translocating P-type ATPase, flippase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00123720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_46570
Tetrahymena borealisEI9_11772.19.997093137033517e-262phospholipid-translocating P-t
ype ATPase, flippase (1263 aa)
OxytrichaContig10486.0.g729.997093137033517e-262E1-E2 ATPase
DictyBaseDDB_G02765412.0007442334946695e-153DDB_G0276541 on chromosome: 2
position 6819663 to 6825311
WormBaseWBGene000191669.99530525570754e-113locus:tat-2 status:Partially
_confirmed UniProt:U4PRL1
protein_id:CDH93216.1
SGDYAL026C3.0009992673984943e-111DRS2 Aminophospholipid translo
case (flippase) that maintains
membrane lipid asymmetry in p
ost-Golgi secretory vesicles;
contributes to clathrin-coated
vesicle formation and endocyt
osis; mutations in human homol
og ATP8B1 result in liver dise
ase

General Information

Paragraph NoGene NameParagraph Text
19FLP11,
FLP18,
FLP17,
FLP8,
FLP16,
FLP15,
FLP14,
FLP6,
FLP13,
FLP10,
FLP2,
FLP1,
DNF1 ,
FLP9,
FLP12,
FLP4,
FLP7,
FLP5,
FLP19
The phospholipid flippase family of genes in Tetrahymena contains 20 members, FLP1-FLP20. Preliminary studies show that many of these genes are differentially regulated in response to temperature and/or the presence of a polycyclic aromatic hydrocarbon (pyrene).

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00123720(coding)
ATGAGTCAAAATACTAATAAAAACTAAACTCAATAAGTAGAAATGAGGATGAGCCAAAAT
CTGAATAAAAGTTTATCTAATGTTGATAAATAAGTAGGAGGTAGAAGAATATTTCACTTT
GGCTCATAGTCTATGAATAAAGATATGCGCTTTAGTTCAAATTTTATAAAGACTTCTAAG
TATACTGTATGGAATTTTTTGCCTCTGTGCTTGTTGTAGCAATTCAAAAGATATGCAAAT
ATTTATTTTCTTGTAATTGCAATTCTGTAAAGTATCCCAGCAATATCTCCATTAAATCCA
TTTTCTGCATGGGCTCCTTTAGTTATAGTTATAGGTATTTCTATGGCCAGAGAAGGGTAT
GAAGACTATTAAAGATATAAATCCGATCTAGAAATGAACTCTAGTACAACTACAGTTTAC
AGAGACTCAAAGTTCATTACGTGTAAATGGGGAGATGTTTTAGTTGGAGATTTAGTAAAA
ATAGTAGAAAATGAAACATTTCCATCAGATATAATAGTATTAAATACATCAAACGAAGGG
GGAGTGTGCTTTATTGAGACAAGCTCTCTTGATGGTGAGAAAAACTATAAAAATAAAGAA
GCTATGGCTTAGACTCTAAAATGGGTATAACCCGACAAATCTGTGATAAGACTTGTGGGA
TAGGTAAATTGTATATTACCTAATGAGCTTCTTCATTAATTTGAAGGTACTATTCAATAC
CATGGTGAGTAATATATTGTAGGAGCTAAGTAATTTTTATTGCGTGGTGCTAAATTAAAA
AATACAAAATGGATAGCTGGTATAGTTGTATATACAGGAGAAGACACAAAGATTATGAAA
AATGCTGATAAGTCTAAATACAAAGTTTCAAATATTGAATCACAAACAAATAAATTGATC
ATAGCAATATTCATATTCTAACTAATCATTAGTATTTGCTCAGCTATTGGAAATTCTATT
TGGAATCATTAAAAAGGTCCAGAATATCCATATATACCGAAACCATCAAGTACCGATTTT
GAAGGTTTTCTCACTTTCTTGACCTATATAGTCTTGAATAACACTATGATACCAATTTCT
TTGATTGTCTCTCTTGAAGTAGTTAAATTAGTCCAAGGATTTATAATAGCTGCTGACGAA
GAGTTAATACAAAAGGAAGATGGAAGAACAAAGCTCCCAAAAGTTTATACAACATCTATT
AATGAAGAGCTTGGATAAGTATAATACATCTTCAGTGATAAGACAGGAACTTTAACTTGC
AATAAAATGGAACTCAAATTATGCTGCATAGGAAACCAGCTTTATGGAGACTAGAAGGTA
CTAAAAGAGCTATCTTCACCTTAAAAAAGAAAGAGATCTTTGAGAAAACCCACTCTTGTT
GATGAAAATTCTGAAATTGTTTTTTACAAGAGGGATGAAAATTTAGTTAAGGTTTTAAAT
GGAATAGGAAACTTTTAAATTGATCATTTTTAAATGTTTGACTCAAAGACTTAATCAAAA
TCCTTATTCACATTGGTAACTTAGAAAGATATTGCTCATGAGTATCTCTTACTGCTAGCA
ACTTGTCATGAATGCGTTATAGAATAAAAAGATCAGTCTGAAATGGAAGATGCAGAAAAA
TAAACTGATAATAAATCAGTTACTAAAAAACCCATCCCATTTAGCAATAGTAGCTAAAAC
GCTAATACTTCAATACCAAAATAGGCAAATAATAATGCTATTAAAATAGAAATGGGCCAA
ATGAACTTGGATCCAAGCCCTGTTCCATCAAGCTAAAACACAACAACTCCTATTAAGCAC
TCTGAAATAAAATATTAAGGTCCATCACCAGATGAAGTAACATTGGTCGATACAGCTCGC
CATTATGGATATGTCTTTTTAGGATCAAACTCAGCTTCAATAAATCTTGAAGTTCAAGGA
GAAAAAGTGTAACTAGAATTATTGAAATTATTTGAGTTTAATAGTGATAGAAAGAGAATG
TCTGTAATTGTCCGTCATAATGGAGTGATTAAAATGTATATTAAAGGAGCTGATAATAAA
ATAAAGGAAAGATTAAATTCTCAAATCGAATAGCCTTTTCTTCATGAAATATAGTAAAGA
ATTGATGAATTTTCTAAAAAAGGTCTTAGAACTCTTTTAGTTGCTATGAGAATATTGGAA
GAAAACGAGTATAAAGAGTTGGAAGCAAAATATCAAGCTGCTGGTAATGCTGCAAATCGT
GAAGAATAATTCTTTAAAATAGCTGAAGATTATGAGAAAGATTTGTATTTAATTGGAGCA
ACAGCTGTTGAAGATAAATTATAAGATAGAGTTCCTGAAACAATAAGAGACATGCTATAA
GCAAAAATAAATGTTTGGATGCTTACTGGTGATAAAATGGAAACAGCTGAAAATATTGCT
AAGAGTTGCAAGCTAATTTAATCTCATTTTAGAATCTTGAGATATCATATTAATAAGCCT
CCTATTAAGGAAGGTTAAGTATATAAGACTCCACCCAATCTAGTAAAGGATGAATTAACT
AGATTATTCTATGAAAAAGAGGAGCTTATGAGATAAAAAAAGGAAAAGGCTTTGTTGATT
GAAGGAGAAGATCTAGGTGATGTTTTGTTAGATGATGAATTTATGGATATGCTTATTGCT
ACTGTAAAAGATTGCGAATCAGTTGTGTGCTGTAGAGCAACTCCTAAGTAAAAAGCTTAA
GTTGTTAAATTAGTCAAAGACAAATTACAAAAAATTACTTTGGCAATCGGTGATGGAGCT
AATGATGTTAATATGATTCAAGAAGCTCACATTGGTATTGGTCTCTTTGGCCAGGAAGGT
ATGAGAGCAGTTTAAGCATCAGATTACGCATTACCTGAATTCAAGGGCTTGTGGAGATTG
TTACTTGTGCACGGAAGATGGAACTATATTAGAATTTCTGAAATGATCTTGTACTTTTTC
TATAAAAACTTTATCTTCACAATTCCTTAATTCTTCTTTAGTTTTTCAAATGGATTTAGT
GGTCAGAGTATTTTTGATGACTATTATATAACTCTTTATAATATCATTTTTACTGCTTTT
CCATTGATAGTTAGAGCAGTAACTGAGTAGGATTTGTACTATAAAATTCGTGAAAAAGAT
CAAGAAAACTAGGAAAGACTAATCAATCATAATAAACTGATGAAATTATTCCCAAAAGCT
TACTACGTTGGCTAGCAAAACCTTATCTTTAATACAAAAAACTTTTTAATATGGATAGCT
CAAGCATTAGTTCACGCATCTATAATTTATGCTGTAGTTTAATGCTCAATTTAGAAAGAT
GCTATGTCATCTGATGGCTATTCACCAGATCTCTGGGTTGTATCAATTACATTATATTCT
GCTATTATATTAGTTGTTGATGTAAAACTTGCAGTAAATACTAGATACTGGACAATGATT
ATGCTCCTCTCTATAATATTTACTTCATTGGTTCCTTATTTCCTGTACATTTTTGTTGCC
AATTTGATAGAGTAGTTCAATGTTTATCTCACAGCTCAAGCTATATTTACAATGCCTGAT
TTTTATTTAATTATATTCTTCTCGCTCTTCTTGATTGTTACTTTCGATCTTTTCATTATA
TATCTTAATTAAGTAGATTACAGAGGCTTTATTGAGCACCTAAGATCTTTAATTAAAGAA
AAGTAAAACCTAGACAATAGCGAATATATTGAGAGACTAGAAAATGTAGATATGAACAAC
AACTTTGGAAGAAATATTCCTTCAAATGTACCTGTTGAGAGAAAATATGAGCAATATGCA
GCTTGA


>TTHERM_00123720(protein)
MSQNTNKNQTQQVEMRMSQNLNKSLSNVDKQVGGRRIFHFGSQSMNKDMRFSSNFIKTSK
YTVWNFLPLCLLQQFKRYANIYFLVIAILQSIPAISPLNPFSAWAPLVIVIGISMAREGY
EDYQRYKSDLEMNSSTTTVYRDSKFITCKWGDVLVGDLVKIVENETFPSDIIVLNTSNEG
GVCFIETSSLDGEKNYKNKEAMAQTLKWVQPDKSVIRLVGQVNCILPNELLHQFEGTIQY
HGEQYIVGAKQFLLRGAKLKNTKWIAGIVVYTGEDTKIMKNADKSKYKVSNIESQTNKLI
IAIFIFQLIISICSAIGNSIWNHQKGPEYPYIPKPSSTDFEGFLTFLTYIVLNNTMIPIS
LIVSLEVVKLVQGFIIAADEELIQKEDGRTKLPKVYTTSINEELGQVQYIFSDKTGTLTC
NKMELKLCCIGNQLYGDQKVLKELSSPQKRKRSLRKPTLVDENSEIVFYKRDENLVKVLN
GIGNFQIDHFQMFDSKTQSKSLFTLVTQKDIAHEYLLLLATCHECVIEQKDQSEMEDAEK
QTDNKSVTKKPIPFSNSSQNANTSIPKQANNNAIKIEMGQMNLDPSPVPSSQNTTTPIKH
SEIKYQGPSPDEVTLVDTARHYGYVFLGSNSASINLEVQGEKVQLELLKLFEFNSDRKRM
SVIVRHNGVIKMYIKGADNKIKERLNSQIEQPFLHEIQQRIDEFSKKGLRTLLVAMRILE
ENEYKELEAKYQAAGNAANREEQFFKIAEDYEKDLYLIGATAVEDKLQDRVPETIRDMLQ
AKINVWMLTGDKMETAENIAKSCKLIQSHFRILRYHINKPPIKEGQVYKTPPNLVKDELT
RLFYEKEELMRQKKEKALLIEGEDLGDVLLDDEFMDMLIATVKDCESVVCCRATPKQKAQ
VVKLVKDKLQKITLAIGDGANDVNMIQEAHIGIGLFGQEGMRAVQASDYALPEFKGLWRL
LLVHGRWNYIRISEMILYFFYKNFIFTIPQFFFSFSNGFSGQSIFDDYYITLYNIIFTAF
PLIVRAVTEQDLYYKIREKDQENQERLINHNKLMKLFPKAYYVGQQNLIFNTKNFLIWIA
QALVHASIIYAVVQCSIQKDAMSSDGYSPDLWVVSITLYSAIILVVDVKLAVNTRYWTMI
MLLSIIFTSLVPYFLYIFVANLIEQFNVYLTAQAIFTMPDFYLIIFFSLFLIVTFDLFII
YLNQVDYRGFIEHLRSLIKEKQNLDNSEYIERLENVDMNNNFGRNIPSNVPVERKYEQYA
A


>TTHERM_00123720(gene)
ATGAGTCAAAATACTAATAAAAACTAAACTCAATAAGTAGAAATGAGGATGAGCCAAAAT
CTGAATAAAAGTTTATCTAATGTTGATAAATAAGTAGGAGGTAGAAGAATATTTCACTTT
GGCTCATAGTCTATGAATAAAGATATGCGCTTTAGTTCAAATTTTATAAAGACTTCTAAG
TATACTGTATGGAATTTTTTGCCTCTGTGCTTGTTGTAGCAATTCAAAAGATATGCAAAT
ATTTATTTTCTTGTAATTGCAATTCTGTAAAGTATCCCAGCAATATCTCCATTAAATCCA
TTTTCTGCATGGGCTCCTTTAGTTATAGTTATAGGTATTTCTATGGCCAGAGAAGGGTAT
GAAGACTATTAAAGATATAAATCCGATCTAGAAATGAACTCTAGTACAACTACAGTTTAC
AGAGACTCAAAGTTCATTACGTGTAAATGGGGAGATGTTTTAGTTGGAGATTTAGTAAAA
ATAGTAGAAAATGAAACATTTCCATCAGATATAATAGTATTAAATACATCAAACGAAGGG
TAAATAATTTTAAATTACAAATAGGATATAAAAAAGTTTTATCAATTTTTCATCTAGTTT
ATTTTAAATTACAACATTGCACTAGTAGTAATTTTAGTTAGCTCTAAATATTTAATATTT
ATTACAGTAAATGAGAATGAGTGAATGAATGAATAAATCAAATAACTAACTAACTAATTA
ATGAATACTTTGTTTGAAATTAACAATTTAAGATACCTTTGAAATAATAAAGGTTTGATT
TCTATCATATTATTTATCTCCCACCATCCATTTGATTTATTTTTTAACGAATGACAATTA
ATTGCCTTATCTAAAACTATATATCAAGGGATTTAATATGATTAAAATCTCCTAAAAGCA
GTCCATCAATCTATAAAAAATTAAATTTTCAATTATAAATTATTCTTTTTTAAAAAATAT
TACTATTATTATTAATACTTAATTACTAAATTTTTAGATTGATCAAAATAATGAATTAAA
TTAAAATCAAGCACGAATTTATTACTAAACTGATTAAGTTATTTCTAATTTTTAATTACA
AAAAATATTCAAATTTTATATAATTTCCAATTTTTCAAGAAGAAAAGAAGAAAAATTTTT
GAGAATATTTTAAAAATTAAAAAATAAATTAATTGCTTTTTTAATTATAATTGAAAAAAA
AACATTTTTTGATTAAAATCATTTTTCTGAAAAAATTAATAAAAAATATTTTTTTAATAA
TAAATTATTAGGGGAGTGTGCTTTATTGAGACAAGCTCTCTTGATGGTGAGAAAAACTAT
AAAAATAAAGAAGCTATGGCTTAGACTCTAAAATGGGTATAACCCGACAAATCTGTGATA
AGACTTGTGGGATAGGTAAATTGTATATTACCTAATGAGCTTCTTCATTAATTTGAAGGT
ACTATTCAATACCATGGTGAGTAATATATTGTAGGAGCTAAGTAATTTTTATTGCGTGGT
GCTAAATTAAAAAATACAAAATGGATAGCTGGTATAGTTGTATATACAGGAGAAGACACA
AAGATTATGAAAAATGCTGATAAGTCTAAATACAAAGTTTCAAATATTGAATCACAAACA
AATAAATTGATCATAGCAATATTCATATTCTAACTAATCATTAGTATTTGCTCAGCTATT
GGAAATTCTATTTGGAATCATTAAAAAGGTCCAGAATATCCATATATACCGAAACCATCA
AGTACCGATTTTGAAGGTTTTCTCACTTTCTTGACCTATATAGTCTTGAATAACACTATG
ATACCAATTTCTTTGATTGTCTCTCTTGAAGTAGTTAAATTAGTCCAAGGATTTATAATA
GCTGCTGACGAAGAGTTAATACAAAAGGAAGATGGAAGAACAAAGCTCCCAAAAGTTTAT
ACAACATCTATTAATGAAGAGCTTGGATAAGTATAATACATCTTCAGTGATAAGACAGGA
ACTTTAACTTGCAATAAAATGGAACTCAAATTATGCTGCATAGGAAACCAGCTTTATGGA
GACTAGAAGGTACTAAAAGAGCTATCTTCACCTTAAAAAAGAAAGAGATCTTTGAGAAAA
CCCACTCTTGTTGATGAAAATTCTGAAATTGTTTTTTACAAGAGGGATGAAAATTTAGTT
AAGGTTTTAAATGGAATAGGAAACTTTTAAATTGATCATTTTTAAATGTTTGACTCAAAG
ACTTAATCAAAATCCTTATTCACATTGGTAACTTAGAAAGATATTGCTCATGAGTATCTC
TTACTGCTAGCAACTTGTCATGAATGCGTTATAGAATAAAAAGATCAGTCTGAAATGGAA
GATGCAGAAAAATAAACTGATAATAAATCAGTTACTAAAAAACCCATCCCATTTAGCAAT
AGTAGCTAAAACGCTAATACTTCAATACCAAAATAGGCAAATAATAATGCTATTAAAATA
GAAATGGGCCAAATGAACTTGGATCCAAGCCCTGTTCCATCAAGCTAAAACACAACAACT
CCTATTAAGCACTCTGAAATAAAATATTAAGTAAATAAATTATTTCATTCATTTTTGAAT
AGAAATAAATAAAATAAAAAAATTTATATTCAAATAAAAATAAAATTTATTATTTTGAAT
TTAGAAACCATATATTATTTTTAACAAACAAACAAAGGGTCCATCACCAGATGAAGTAAC
ATTGGTCGATACAGCTCGCCATTATGGATATGTCTTTTTAGGATCAAACTCAGCTTCAAT
AAATCTTGAAGTTCAAGGAGAAAAAGTGTAACTAGAATTATTGAAATTATTTGAGTTTAA
TAGTGATAGAAAGAGAATGTCTGTAATTGTCCGTCATAATGGAGTGATTAAAATGTATAT
TAAAGGAGCTGATAATAAAATAAAGGAAAGATTAAATTCTCAAATCGAATAGCCTTTTCT
TCATGAAATATAGTAAAGAATTGATGAATTTTCTAAAAAAGGTCTTAGAACTCTTTTAGT
TGCTATGAGAATATTGGAAGAAAACGAGTATAAAGAGTTGGAAGCAAAATATCAAGCTGC
TGGTAATGCTGCAAATCGTGAAGAATAATTCTTTAAAATAGCTGAAGATTATGAGAAAGA
TTTGTATTTAATTGGAGCAACAGGTAAATTTCATCATTTTATTTTCGAAAAGCCTTTAAA
ATTAATTTAAATATGAAAAACTAAATGAAAATATTTTTTTGAATTTTTAAAAAATTAGCT
GTTGAAGATAAATTATAAGATAGAGTTCCTGAAACAATAAGAGACATGCTATAAGCAAGT
AATTTTTATTTGCTAAGTTCTTTAATAAATTTATTTATTATTTATATTATTTAGAAATAA
ATGTTTGGATGCTTACTGGTGATAAAATGGAAACAGCTGAAAATATTGCTAAGAGTTGCA
AGCTAATTTAATCTCATTTTAGAATCTTGAGATATCATATTAATAAGCCTCCTATTAAGG
AAGGTTAAGTATATAAGACTCCACCCAATCTAGTAAAGGATGAATTAACTAGATTATTCT
ATGAAAAAGAGGAGCTTATGAGATAAAAAAAGGAAAAGGCTTTGTTGATTGAAGGAGAAG
ATCTAGGTGATGTTTTGTTAGATGATGAATTTATGGATATGCTTATTGCTACTGTAAAAG
ATTGCGAATCAGTTGTGTGCTGTAGAGCAACTCCTAAGTAAAAAGCTTAAGTTGTTAAAT
TAGTCAAAGACAAATTACAAAAAATTACTTTGGCAATCGGTGATGGAGCTAATGATGTTA
ATATGATTCAAGAAGCTCACATTGGTATTGGTCTCTTTGGCCAGGAAGGTATGAGAGCAG
TTTAAGCATCAGATTACGCATTACCTGAATTCAAGGGCTTGTGGAGATTGTTACTTGTGC
ACGGAAGGTAAAAAAAATTTGATCATCAATTAAATTTAATATTTATTGAAATTTTTTATT
ATAAATAATAAATAGATGGAACTATATTAGAATTTCTGAAATGATCTTGTACTTTTTCTA
TAAAAACTTTATCTTCACAATTCCTTAATTCTTCTTTAGTTTTTCAAATGGATTTAGTGG
TCAGAGTATTTTTGATGACTATTATATAACTCTTTATAATATCATTTTTACTGCTTTTCC
ATTGATAGTTAGAGCAGTAACTGAGTAGGATTTGTACTATAAAATTCGTGAAAAAGATCA
AGAAAACTAGGAAAGACTAATCAATCATAATAAACTGATGAAATTATTCCCAAAAGCTTA
CTACGTTGGCTAGCAAAACCTTATCTTTAATACAAAAAACTTTTTAATATGGATAGCTCA
AGCATTAGTTCACGCATCTATAATTTATGCTGTAGTTTAATGCTCAATTTAGAAAGATGC
TATGTCATCTGATGGCTATTCACCAGATCTCTGGGTTGTATCAATTACATTATATTCTGC
TATTATATTAGTTGTTGATGTAAAACTTGCAGTAAATACTAGATACTGGACAATGATTAT
GCTCCTCTCTATAATATTTACTTCATTGGTTCCTTATTTCCTGTACATTTTTGTTGCCAA
TTTGATAGAGTAGTTCAATGTTTATCTCACAGCTCAAGCTATATTTACAATGCCTGATTT
TTATTTAATTATATTCTTCTCGCTCTTCTTGATTGTTACTTTCGATCTTTTCATTATATA
TCTTAATTAAGTAGATTACAGAGGCTTTATTGAGCACCTAAGATCTTTAATTAAAGAAAA
GTAAAACCTAGACAATAGCGAATATATTGAGAGACTAGAAAATGTAGATATGAACAACAA
CTTTGGAAGAAATATTCCTTCAAATGTACCTGTTGAGAGAAAATATGAGCAATATGCAGC
TTGA