Identifiers and Description

Gene Model Identifier

TTHERM_00797940

Standard Name

FLP11 (FLiPpase)

Aliases

PreTt23233 | 135.m00084

Description

Phospholipid-translocating P-type ATPase, flippase family protein. Sequence similarity to the HisK protein kinase family (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF08513 ) LisH
  • ( PF00122 ) E1-E2 ATPase
  • ( PF04971 ) Lysis protein S
  • ( TIGR01612 ) rhoptry protein
  • ( TIGR00099 ) Cof-like hydrolase
  • ( TIGR01257 ) rim ABC transporter
  • ( TIGR01386 ) heavy metal sensor kinase
  • ( TIGR00338 ) phosphoserine phosphatase SerB
  • ( PF00072 ) response regulator receiver domain
  • ( TIGR00188 ) ribonuclease P protein component
  • ( TIGR02956 ) TMAO reductase sytem sensor TorS
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR02791 ) P-type DNA transfer protein VirB5
  • ( PF00702 ) haloacid dehalogenase-like hydrolase
  • ( PF00512 ) His Kinase A (phosphoacceptor) domain
  • ( TIGR02966 ) phosphate regulon sensor kinase PhoR
  • ( TIGR01484 ) HAD-superfamily hydrolase, subfamily IIB
  • ( TIGR02938 ) nitrogen fixation negative regulator NifL
  • ( PF00902 ) Sec-independent protein translocase protein (TatC)
  • ( TIGR01652 ) phospholipid-translocating P-type ATPase, flippase
  • ( TIGR01494 ) ATPase, P-type (transporting), HAD superfamily,
  • ( PF02518 ) ATPase, histidine kinase-, DNA gyrase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00797940

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10535.19.997093137033517e-262phospholipid-translocating P-t
ype ATPase, flippase (1573 aa)
OxytrichaContig7971.0.g575.000307300873256e-47Histidine kinase-, DNA gyrase
B-, and HSP90-like ATPase
DictyBaseDDB_G02829279.99648502569394e-38dhkL on chromosome: 4 position
127874 to 133086
Stentor CoeruleusSteCoe_188001.5628821893349888e-18
SGDYIL147C0.000000000007996637300921877SLN1 Histidine kinase osmosens
or that regulates a MAP kinase
cascade; transmembrane protei
n with an intracellular kinase
domain that signals to Ypd1p
and Ssk1p, thereby forming a p
hosphorelay system similar to
bacterial two-component regula
tors

General Information

Paragraph NoGene NameParagraph Text
19FLP11,
FLP18,
FLP17,
FLP8,
FLP16,
FLP15,
FLP14,
FLP6,
FLP13,
FLP10,
FLP2,
FLP1,
DNF1 ,
FLP9,
FLP12,
FLP4,
FLP7,
FLP5,
FLP19
The phospholipid flippase family of genes in Tetrahymena contains 20 members, FLP1-FLP20. Preliminary studies show that many of these genes are differentially regulated in response to temperature and/or the presence of a polycyclic aromatic hydrocarbon (pyrene).

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00797940(coding)
ATGGAGATATCAGATTAAAAATTACCAAAGATGGTAATTTCGTCTTCTCAAATACTAAAT
TTGTACTACAGCTTTAATTTTAGGTTTTTCACGCACTCAATAGCACTGATGGCAATGGCA
ATTATAGATTTAGTGGCGAGTTGCTATTCTAATAATGATAATTCTAAAAAAATGGCAATT
GTATCATGGATTTAGACATGCTTATTTTTTATAGAAATAGTTGCGATTTGTCTTATTAAT
ACTGGAAAAATTCCTAGTTTTTAAAAGTTCTTTTAGGAATGGCAGATCAGCTTATTTAAA
AATTGTTTGTGCATAGGAGAAGTATCTCTTCAGATTGAGTATTTAATGCAGGAAGATATG
GGAATGAAAATCATGGTCTCTTTTTTTAGGATAGTTTTTATTTTAGCCACCTTCACTTAG
TGGGAGAAAAAGAACATTTATCGCTTTTTAAATCTAATTTTTACTTTTATCTATTTATAA
CTCAGGTGTATAACTTATACAATGGACTCAATCGCTTCAAGAATTAATCTTCTACTATTA
TTTTTAATTTTTTTGCAAACAATTAACGGAGATGTTTAGCACATTCTAGATTCTCCACAT
TTGATATCTCAAGAATAAGACCTAATCCTGACCCAAAAAAGGATGACATTTAGCGAGTAG
AATTATTAAAACCCAAGGTAGAACACCAGAGGTATCACGTTTGGAGGAAGTTTAGGTGGT
CTTTTTAGTTTTATTAACAAGCCAAAAACTATGACTAATAGTTCTATTTCCAAAGAATGT
TAATAACAAGGGAAAACCTCAATTGCAAGCAACCACATATAAAATAATGGCACTCATACT
TTATTAGCAAATGAAGTTAATTAAAAAGGTTTGCATAAAAATGGGCAGTAAATTAATGAG
TAGCATATAGCAACAGATAAAAATGGTTAAGCCTGCTATCAATTTACTTTATAAACGAAT
GGACCTGCTAATTCCGAAAACAACACTAGTAGCAACTTGGTATAAAATACTGAGTAATTT
ACAGTGAGAAAAAATTTAGAAAAATCTCTTACTGCGAAATTCGGCAGTCCGAAGTTGGTA
TGCTAGTAGAATTCAAACGAGGTAGATGACATCAATTTATCTGAAAATAATAATGAAGAT
TTTGTCAAAATCTAAAATGCAAATAGTGAATTTTGTAGTCCTAAAACTTGTTAAGAATAT
TCGAAATAAAGGAAAAAGAGCAATTTTTAGATGTATGCTACTCAGGAAAACAGTAAAGAA
AATCACCAAGAAATTGAAGATAAATAAATTTAAAAACCAAATAAAAGCCATTAAGATTTG
TAAACTTCAGTTTTGAGTCCAGATTTTCTTGCCAACAGGAAAAATAATAAAAATGAAAAC
AGCATTCAAAGTATACATTAATATTAAAATAGCAAGATGATTGAACAAGAAAAGCAAAGC
GATAAAAGACTTTAAGAAATAAAACTGTTCAAATTACCTTTAACCACAAAAGATGAAGAA
AATTATGCTCAAATTAACCAAATCAAATAGAACTATCAATCTTAGGAATACTCAAAAAAT
ACTCAGATTTCAATTAGTCCTAAAAGTATTTAATCATATGAACTCTCCTTATCTCCAGTC
TTACAGCTCAGTGTCCCCAATAACTCACAATTCTATTAGATGTTTTTTTAAATTTTGCCT
GAAGGTATTCTTTTACTTGGCTCCAAGTAAAATAAAGTGCATGTCCAGAATAGAATGTTA
GAGAGACTAATGAATATCAAAGGAGGCTCCTTAATTGATAAATTTTTCAAATTAGAAAAT
AATTTAAATTTAGGAGAAACTAGCGACACTTCAGGAACACTAGACATACTCCCCATGATT
ATGAATATGAAAACAATACTGAATGAATCTACTTCACAATAAAGGATATCTTCAATTCAA
TAGCTTAATTAAAACATTTTGCCAAATTAGCAATAAAACGTTGATTCTAAAATGACTTAG
CCATCTCAGTTCTAGCCTAAGCCTTAAGCAGGATCAGACAATGACGAAAGGACTAACACT
TAAGGCAGTAACAATCAAATACCATCCATGCCAAATGTTAGCATTTTACAATTAGAAGAT
CCTAAATATAACCAACAAGCATATGGACAGAGCTTGTAAAATAGTCCTAGTATAGGCTAA
CAGCAAAACTAAATTGATGAGTCGATTCTATCTAAATCTAATTTAAAGTACATCCCTTAG
CCTATAAGATAGAATATGAATCAAAAATTAAATATGAATGCTTAATATAATAATAATATT
ATGAATCGTAAGGAAAAAGACTTAGCAGAAGAATAAATTATTAAACAAATTGATTAATAA
AGAAGTCAGTTTACCAATGATATGCAAAAGGAATATTCAAATTCTTATAGCAGCAATCTA
AATTAGAGCGCTCAAACATAAAATAACATAGATGTCACGTACAGCAGAAAAAAGACGATA
GGCGAATTGTACAGAAGCTTAATCAAAGAAATACAGCAAGACATAGAAATGAATGGTTCA
GCAAGTAAATACGAAGCTTTTGAGCACCAAGTTAAGATGATTTGTTCCTTCCCCTATATC
AAAAAGAAAAGAACATCAAATTCAAACTTAAAGTCCTAATTTAATATTTCATAAATGGCG
TATTCAAATATGAACTTGAATATATAATCTGTTTCTAATGTAAAAAGTGACACAAGTGAA
AATGTAGAAAATTGCAAAAAGATTTTCGAAGTCACTTGCATACCCTGCATTATTGAAGGT
CAGCCTTCCGTCCTTTTTGTAGTCAAGGATGTTACCCATTTCAACTAAATCAAGCTCCTC
AAGCACATCAACAAGAATAAATCACAGATGCTATCTTAAGTAGCCCATGAATTTAGAACA
CCTCTAAATTGTATTATATCTATGATGGACTTAGCTAGCATTACCAATCCATAGAGTCAG
ATTTAATAATACTTAAAGCCAGCTTTGACAAGCGCTAAATAGCTAAACTCAATGGTCAAT
GATTTACTAGATCTTGCATAATTAAAGGCTGGTAAGTTTTCTTTAAATATGGAGAGCTTT
AACTTGTAAGAACTAATATCTTAAATTGTTGTTTTGATGAGCATTTAATCTGAGTAAAAG
GGTCTGGCCTTAATATCAAACATAGATCCTCAAATTCCAAACTCAATATATAGCGATCCA
AATCGTCTAAGATAGATTATAATCAACTTGGTTGGAAATTCTTTAAAATTTACTAAAAAA
GGTAGTATAACAATTAAGGCTTCTTTAATCAGCACAAAAGTGATTAAAATAAGTATAATT
GATACTGGTATTGGCATAAAAGAAGAAGATATGGCCAATCTATTCTAAGCTTTTGGAAAA
ATCGCTGGTTAGGAATAAAAACAGCTTAATCCAAACGGTGTCGGATTAGGACTGATGATT
TCTCATGTTCTGGCTAAGAATTTAGGAGAAGGAGAAGGGTTAAAAGTAGAATCTTAAGTA
GGAATAGGCACTGAATTTTATTTTGAGATTGTTAATAACTTGTAAAAAATGAATATCGAT
AAGTCTTTCATTCTAAAATCGTAAATCGTTAAATCTCAATACTACAAGAAATCTCAAATA
GCTTCCATGAAAATTGACTAATAAGGATAGCAATAGCAATATTTATAGCAACAATAGTTG
TAGTATCAGCAATAACAACAATAAAAATAATAATAATAATAATTCATTCAAAAACCTCAA
AATTAAGTGAACAATGATGACCTTAAGAAATGCTCACAAAATTATAACTTTGATGATATT
TTGAAAACTTTTGGGAAAATTGATAGCTATAAAGATATAAGTGGATAAGAAAATAAAGTA
AATAAGCAAGAAGAGTGGAAAGAAAATGGTCACTAGTAGCAGTCAGCTCAAAAAAGAAAG
CCATCCATTCAATTACACAATTCATCTAAACTAAAAAATTCATCTATTCCATCATAGAAT
ACAATTTACACTCCTAAATCGAACTCTTGCAATTAATTAGCAGGTAGTTTGGAAGATCAC
TAGCCAGATATGAATGGTTAAGCTAATTTATCTATATCTGCTTCTCTAAATTAAATGCTA
AACCTTAAATAAACTAAAAATTAAATTATTACTATTCATGAGGAAGAGGGAGAATATGAA
GGAGATGGGTCTGCTAATTTCAACAATGAAAACTCGTAGAAATTTGAAGAAAGAGACCAT
TTAATCAAAAGAAGTAGTAAAAGCTAATTTAGCAATCATAAAAATTAATTCTACTACAAA
GACTAAATTGGCCCAAAAGTTTAACTTAATAGATGTCATATTAGAAATGAAAGTGTAGAT
TATGATGGTTGTGGCGAGAATTTCGGGTTTTTAAGTGATAGACCTAACTAATAAAATGCA
AGTGATAGTGAGAATATAAAAAGTTCCTTTGAAAAAATCCTATTTCCGCCAAATTAGAAA
AAATTTGACATTAGTGGTTTGTTAAACCAAAATTAAAATAATAATGTGGTGAATAGCAAT
ATTTAAAAGCTATAAGTTCAATCACAACTTGATAATTTAATTGGTAAAAATTTGAATAAC
GTAGAAGATTTGCATGATTCTTCGTCCGATGATAAAGAAAGCTCTGTTGCTGATGATGAA
AATTTAAATGATTCTTTTAATGGAAATTTCAAAAAAATGTAAAATAATTCAGATGAATAG
AAACAGCAAGATAGCACTTATAATCAAGGATAGCCAGACAAGAACTCTGATAAAAAAGAT
AACTTAAAGAAAAGAACTTAAAAAAGATATAAAACCAAAATTAAAAGATCTAGCTCATAG
GTAGAATTCTTCGAATCATCTCATAAAAGTGTGAGCTAAAGTCTAAGTGCTTCTGTCTAA
GCAGAAGTAGAAATTTTAACAATAGATGATAATGAATTTAATAATATGGTATTAAAAATG
CACATCGAAAGACTCATCAGGGCAAGAGTTCACTGCGCAATTGATGCCCATGATGCACTA
TCTAAATTGCAAGAGCAATACACGAAGACAAAATCAGGTTTCGATTTAATTTTCTTAGAT
CTCTCAATGCCTGAAATAGACGGTTATGGGACATTCAGCATGATTAAAGATTTTTGTAAC
GAAAAGAGAATCAATTAAAACGTTGTTGCATGTACTGGATACAGCAGTTTAGAAGAAAAA
GACAAGTGCATAGATATTGGCATGGTTGATTATATCTTAAAGCCAATAGAAATACCCAAA
TTAAAAGAAGTATTATCAATCTTCCTAGACGGAAATGCATTCAACAAGTGA


>TTHERM_00797940(protein)
MEISDQKLPKMVISSSQILNLYYSFNFRFFTHSIALMAMAIIDLVASCYSNNDNSKKMAI
VSWIQTCLFFIEIVAICLINTGKIPSFQKFFQEWQISLFKNCLCIGEVSLQIEYLMQEDM
GMKIMVSFFRIVFILATFTQWEKKNIYRFLNLIFTFIYLQLRCITYTMDSIASRINLLLL
FLIFLQTINGDVQHILDSPHLISQEQDLILTQKRMTFSEQNYQNPRQNTRGITFGGSLGG
LFSFINKPKTMTNSSISKECQQQGKTSIASNHIQNNGTHTLLANEVNQKGLHKNGQQINE
QHIATDKNGQACYQFTLQTNGPANSENNTSSNLVQNTEQFTVRKNLEKSLTAKFGSPKLV
CQQNSNEVDDINLSENNNEDFVKIQNANSEFCSPKTCQEYSKQRKKSNFQMYATQENSKE
NHQEIEDKQIQKPNKSHQDLQTSVLSPDFLANRKNNKNENSIQSIHQYQNSKMIEQEKQS
DKRLQEIKLFKLPLTTKDEENYAQINQIKQNYQSQEYSKNTQISISPKSIQSYELSLSPV
LQLSVPNNSQFYQMFFQILPEGILLLGSKQNKVHVQNRMLERLMNIKGGSLIDKFFKLEN
NLNLGETSDTSGTLDILPMIMNMKTILNESTSQQRISSIQQLNQNILPNQQQNVDSKMTQ
PSQFQPKPQAGSDNDERTNTQGSNNQIPSMPNVSILQLEDPKYNQQAYGQSLQNSPSIGQ
QQNQIDESILSKSNLKYIPQPIRQNMNQKLNMNAQYNNNIMNRKEKDLAEEQIIKQIDQQ
RSQFTNDMQKEYSNSYSSNLNQSAQTQNNIDVTYSRKKTIGELYRSLIKEIQQDIEMNGS
ASKYEAFEHQVKMICSFPYIKKKRTSNSNLKSQFNISQMAYSNMNLNIQSVSNVKSDTSE
NVENCKKIFEVTCIPCIIEGQPSVLFVVKDVTHFNQIKLLKHINKNKSQMLSQVAHEFRT
PLNCIISMMDLASITNPQSQIQQYLKPALTSAKQLNSMVNDLLDLAQLKAGKFSLNMESF
NLQELISQIVVLMSIQSEQKGLALISNIDPQIPNSIYSDPNRLRQIIINLVGNSLKFTKK
GSITIKASLISTKVIKISIIDTGIGIKEEDMANLFQAFGKIAGQEQKQLNPNGVGLGLMI
SHVLAKNLGEGEGLKVESQVGIGTEFYFEIVNNLQKMNIDKSFILKSQIVKSQYYKKSQI
ASMKIDQQGQQQQYLQQQQLQYQQQQQQKQQQQQFIQKPQNQVNNDDLKKCSQNYNFDDI
LKTFGKIDSYKDISGQENKVNKQEEWKENGHQQQSAQKRKPSIQLHNSSKLKNSSIPSQN
TIYTPKSNSCNQLAGSLEDHQPDMNGQANLSISASLNQMLNLKQTKNQIITIHEEEGEYE
GDGSANFNNENSQKFEERDHLIKRSSKSQFSNHKNQFYYKDQIGPKVQLNRCHIRNESVD
YDGCGENFGFLSDRPNQQNASDSENIKSSFEKILFPPNQKKFDISGLLNQNQNNNVVNSN
IQKLQVQSQLDNLIGKNLNNVEDLHDSSSDDKESSVADDENLNDSFNGNFKKMQNNSDEQ
KQQDSTYNQGQPDKNSDKKDNLKKRTQKRYKTKIKRSSSQVEFFESSHKSVSQSLSASVQ
AEVEILTIDDNEFNNMVLKMHIERLIRARVHCAIDAHDALSKLQEQYTKTKSGFDLIFLD
LSMPEIDGYGTFSMIKDFCNEKRINQNVVACTGYSSLEEKDKCIDIGMVDYILKPIEIPK
LKEVLSIFLDGNAFNK


>TTHERM_00797940(gene)
ATGGAGATATCAGATTAAAAATTACCAAAGATGGTAATTTCGTCTTCTCAAATACTAAAT
TTGTACTACAGCTTTAATTTTAGGTTTTTCACGCACTCAATAGCACTGATGGCAATGGCA
ATTATAGATTTAGTGGCGAGTTGCTATTCTAATAATGATAATTCTAAAAAAATGGCAATT
GTATCATGGATTTAGACATGCTTATTTTTTATAGAAATAGTTGCGATTTGTCTTATTAAT
ACTGGAAAAATTCCTAGTTTTTAAAAGTTCTTTTAGGAATGGCAGATCAGCTTATTTAAA
AATTGTTTGTGCATAGGAGAAGTATCTCTTCAGATTGAGTATTTAATGCAGGAAGATATG
GGAATGAAAATCATGGTCTCTTTTTTTAGGATAGTTTTTATTTTAGCCACCTTCACTTAG
TGGGAGAAAAAGAACATTTATCGCTTTTTAAATCTAATTTTTACTTTTATCTATTTATAA
CTCAGGTGTATAACTTATACAATGGACTCAATCGCTTCAAGAATTAATCTTCTACTATTA
TTTTTAATTTTTTTGCAAACAATTAACGGAGATGTTTAGCACATTCTAGATTCTCCACAT
TTGATATCTCAAGAATAAGACCTAATCCTGACCCAAAAAAGGATGACATTTAGCGAGTAG
AATTATTAAAACCCAAGGTAGAACACCAGAGGTATCACGTTTGGAGGAAGTTTAGGTGGT
CTTTTTAGTTTTATTAACAAGCCAAAAACTATGACTAATAGTTCTATTTCCAAAGAATGT
TAATAACAAGGGAAAACCTCAATTGCAAGCAACCACATATAAAATAATGGCACTCATACT
TTATTAGCAAATGAAGTTAATTAAAAAGGTTTGCATAAAAATGGGCAGTAAATTAATGAG
TAGCATATAGCAACAGATAAAAATGGTTAAGCCTGCTATCAATTTACTTTATAAACGAAT
GGACCTGCTAATTCCGAAAACAACACTAGTAGCAACTTGGTATAAAATACTGAGTAATTT
ACAGTGAGAAAAAATTTAGAAAAATCTCTTACTGCGAAATTCGGCAGTCCGAAGTTGGTA
TGCTAGTAGAATTCAAACGAGGTAGATGACATCAATTTATCTGAAAATAATAATGAAGAT
TTTGTGTAAGTTTTATAGATTAAATATTTTATTCAAATTAACTTATTTATTTATGCTAAT
GAACTCAAATATTCATTTATCAATCAATCAATCAATCAATCAATCAAATAAATCAAATGG
AACTAAAATTTTATAGAATTTTCAAATTCTTTTACACTTCATTCATTTCTTCCTTTCCTT
ATTTGTTACAATGATATTTAAAAATAAATGAAGACTTTGATTGATTTGATACTTAAAGTA
TATTTTAAACATTTATTTGATAATGGACCAAAATATTTATTTTTTATCAGTTAAATCTGC
AAAATTTATTAAATTTTTAATTTTTAAGTGTTCGATTAATTATTTCAATCACTCAAAATT
ATTCTATTGATTTACTTGCTCGTTTGAAACAAACAAACAAACAGTAAATTAATTATCAGA
TGACGTTATTGAAAATTAGACATAAATTTATTAATTTTTAAATGACATAATAAATATGTT
GAATTATTTATCCAATTAAATAAGTTTTATGAAAAAATAGATTATTTGGATTCAAACAAA
ATTATTTTTTTTAAATAACAAAATTATATTTTTAATTATAGCAAAATCTAAAATGCAAAT
AGTGAATTTTGTAGTCCTAAAACTTGTTAAGAATATTCGAAATAAAGGAAAAAGAGCAAT
TTTTAGATGTATGCTACTCAGGAAAACAGTAAAGAAAATCACCAAGAAATTGAAGATAAA
TAAATTTAAAAACCAAATAAAAGCCATTAAGATTTGTAAACTTCAGTTTTGAGTCCAGAT
TTTCTTGCCAACAGGAAAAATAATAAAAATGAAAACAGCATTCAAAGTATACATTAATAT
TAAAATAGCAAGATGATTGAACAAGAAAAGCAAAGCGATAAAAGACTTTAAGAAATAAAA
CTGTTCAAATTACCTTTAACCACAAAAGATGAAGAAAATTATGCTCAAATTAACCAAATC
AAATAGAACTATCAATCTTAGGAATACTCAAAAAATACTCAGATTTCAATTAGTCCTAAA
AGTATTTAATCATATGAACTCTCCTTATCTCCAGTCTTACAGCTCAGTGTCCCCAATAAC
TCACAATTCTATTAGATGTTTTTTTAAATTTTGCCTGAAGGTATTCTTTTACTTGGCTCC
AAGTAAAATAAAGTGCATGTCCAGAATAGAATGTTAGAGAGACTAATGAATATCAAAGGA
GGCTCCTTAATTGATAAATTTTTCAAATTAGAAAATAATTTAAATTTAGGAGAAACTAGC
GACACTTCAGGAACACTAGACATACTCCCCATGATTATGAATATGAAAACAATACTGAAT
GAATCTACTTCACAATAAAGGATATCTTCAATTCAATAGCTTAATTAAAACATTTTGCCA
AATTAGCAATAAAACGTTGATTCTAAAATGACTTAGCCATCTCAGTTCTAGCCTAAGCCT
TAAGCAGGATCAGACAATGACGAAAGGACTAACACTTAAGGCAGTAACAATCAAATACCA
TCCATGCCAAATGTTAGCATTTTACAATTAGAAGATCCTAAATATAACCAACAAGCATAT
GGACAGAGCTTGTAAAATAGTCCTAGTATAGGCTAACAGCAAAACTAAATTGATGAGTCG
ATTCTATCTAAATCTAATTTAAAGTACATCCCTTAGCCTATAAGATAGAATATGAATCAA
AAATTAAATATGAATGCTTAATATAATAATAATATTATGAATCGTAAGGAAAAAGACTTA
GCAGAAGAATAAATTATTAAACAAATTGATTAATAAAGAAGTCAGTTTACCAATGATATG
CAAAAGGAATATTCAAATTCTTATAGCAGCAATCTAAATTAGAGCGCTCAAACATAAAAT
AACATAGATGTCACGTACAGCAGAAAAAAGACGATAGGCGAATTGTACAGAAGCTTAATC
AAAGAAATACAGCAAGACATAGAAATGAATGGTTCAGCAAGTAAATACGAAGCTTTTGAG
CACCAAGTTAAGATGATTTGTTCCTTCCCCTATATCAAAAAGAAAAGAACATCAAATTCA
AACTTAAAGTCCTAATTTAATATTTCATAAATGGCGTATTCAAATATGAACTTGAATATA
TAATCTGTTTCTAATGTAAAAAGTGACACAAGTGAAAATGTAGAAAATTGCAAAAAGATT
TTCGAAGTCACTTGCATACCCTGCATTATTGAAGGTCAGCCTTCCGTCCTTTTTGTAGTC
AAGGATGTTACCCATTTCAACTAAATCAAGCTCCTCAAGCACATCAACAAGAATAAATCA
CAGATGCTATCTTAAGTAGCCCATGAATTTAGAACACCTCTAAATTGTATTATATCTATG
ATGGACTTAGCTAGCATTACCAATCCATAGTAATTAATTTACTAATTTTTTATATATTCA
AGAATAATTAAGAGAAATAAACAAAAACAATGAATAACTTGATTGTTTTATTTCCAATTT
TTTATTAATTTATAAAAATTATTAATATTTTTAGTCTTCTATTCTATTTTATTTGAAAAT
GATGTATTAAATCCTTTTGTTTATTATTAAAGGAGTCAGATTTAATAATACTTAAAGCCA
GCTTTGACAAGCGCTAAATAGCTAAACTCAATGGTCAATGATTTACTAGATCTTGCATAA
TTAAAGGCTGGTAAGTTTTCTTTAAATATGGAGAGCTTTAACTTGTAAGAACTAATATCT
TAAATTGTTGTTTTGATGAGCATTTAATCTGAGTAAAAGGGTCTGGCCTTAATATCAAAC
ATAGATCCTCAAATTCCAAACTCAATATATAGCGATCCAAATCGTCTAAGATAGATTATA
ATCAACTTGGTTGGAAATTCTTTAAAATTTACTAAAAAAGGTAGTATAACAATTAAGGCT
TCTTTAATCAGCACAAAAGTGATTAAAATAAGTATAATTGATACTGGTATTGGCATAAAA
GAAGAAGATATGGCCAATCTATTCTAAGCTTTTGGAAAAATCGCTGGTTAGGAATAAAAA
CAGCTTAATCCAAACGGTGTCGGATTAGGACTGATGATTTCTCATGTTCTGGCTAAGAAT
TTAGGAGAAGGAGAAGGGTTAAAAGTAGAATCTTAAGTAGGAATAGGCACTGAATTTTAT
TTTGAGATTGTTAATAACTTGTAAAAAATGAATATCGATAAGTCTTTCATTCTAAAATCG
TAAATCGTTAAATCTCAATACTACAAGAAATCTCAAATAGCTTCCATGAAAATTGACTAA
TAAGGATAGCAATAGCAATATTTATAGCAACAATAGTTGTAGTATCAGCAATAACAACAA
TAAAAATAATAATAATAATAATTCATTCAAAAACCTCAAAATTAAGTGAACAATGATGAC
CTTAAGAAATGCTCACAAAATTATAACTTTGATGATATTTTGAAAACTTTTGGGAAAATT
GATAGCTATAAAGATATAAGTGGATAAGAAAATAAAGTAAATAAGCAAGAAGAGTGGAAA
GAAAATGGTCACTAGTAGCAGTCAGCTCAAAAAAGAAAGCCATCCATTCAATTACACAAT
TCATCTAAACTAAAAAATTCATCTATTCCATCATAGAATACAATTTACACTCCTAAATCG
AACTCTTGCAATTAATTAGCAGGTAGTTTGGAAGATCACTAGCCAGATATGAATGGTTAA
GCTAATTTATCTATATCTGCTTCTCTAAATTAAATGCTAAACCTTAAATAAACTAAAAAT
TAAATTATTACTATTCATGAGGAAGAGGGAGAATATGAAGGAGATGGGTCTGCTAATTTC
AACAATGAAAACTCGTAGAAATTTGAAGAAAGAGACCATTTAATCAAAAGAAGTAGTAAA
AGCTAATTTAGCAATCATAAAAATTAATTCTACTACAAAGACTAAATTGGCCCAAAAGTT
TAACTTAATAGATGTCATATTAGAAATGAAAGTGTAGATTATGATGGTTGTGGCGAGAAT
TTCGGGTTTTTAAGTGATAGACCTAACTAATAAAATGCAAGTGATAGTGAGAATATAAAA
AGTTCCTTTGAAAAAATCCTATTTCCGCCAAATTAGAAAAAATTTGACATTAGTGGTTTG
TTAAACCAAAATTAAAATAATAATGTGGTGAATAGCAATATTTAAAAGCTATAAGTTCAA
TCACAACTTGATAATTTAATTGGTAAAAATTTGAATAACGTAGAAGATTTGCATGATTCT
TCGTCCGATGATAAAGAAAGCTCTGTTGCTGATGATGAAAATTTAAATGATTCTTTTAAT
GGAAATTTCAAAAAAATGTAAAATAATTCAGATGAATAGAAACAGCAAGATAGCACTTAT
AATCAAGGATAGCCAGACAAGAACTCTGATAAAAAAGATAACTTAAAGAAAAGAACTTAA
AAAAGATATAAAACCAAAATTAAAAGATCTAGCTCATAGGTAGAATTCTTCGAATCATCT
CATAAAAGTGTGAGCTAAAGTCTAAGTGCTTCTGTCTAAGCAGAAGTAGAAATTTTAACA
ATAGATGATAATGAATTTAATAATATGGTATTAAAAATGCACATCGAAAGACTCATCAGG
GCAAGAGTTCACTGCGCAATTGATGCCCATGATGCACTATCTAAATTGCAAGAGCAATAC
ACGAAGACAAAATCAGGTTTCGATTTAATTTTCTTAGATCTCTCAATGCCTGAAATAGAC
GGTTATGGGACATTCAGCATGATTAAAGATTTTTGTAACGAAAAGAGAATCAATTAAAAC
GTTGTTGCATGTACTGGATACAGCAGTTTAGAAGAAAAAGACAAGTGCATAGATATTGGC
ATGGTTGATTATATCTTAAAGCCAATAGAAATACCCAAATTAAAAGAAGTATTATCAATC
TTCCTAGACGGAAATGCATTCAACAAGTGA