Identifiers and Description

Gene Model Identifier

TTHERM_00372460

Standard Name

FLP10 (FLiPpase)

Aliases

PreTt28660 | 39.m00233 | 3693.m00079

Description

phospholipid-translocating P-type ATPase, flippase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00122 ) E1-E2 ATPase
  • ( TIGR00099 ) Cof-like hydrolase
  • ( TIGR00338 ) phosphoserine phosphatase SerB
  • ( PF00702 ) haloacid dehalogenase-like hydrolase
  • ( PF08282 ) haloacid dehalogenase-like hydrolase
  • ( TIGR01524 ) magnesium-translocating P-type ATPase
  • ( TIGR01525 ) heavy metal translocating P-type ATPase
  • ( TIGR01484 ) HAD-superfamily hydrolase, subfamily IIB
  • ( TIGR01647 ) plasma-membrane proton-efflux P-type ATPase
  • ( TIGR01522 ) calcium-transporting P-type ATPase, PMR1-type
  • ( TIGR01517 ) calcium-translocating P-type ATPase, PMCA-type
  • ( TIGR01116 ) calcium-translocating P-type ATPase, SERCA-type
  • ( TIGR01523 ) potassium/sodium efflux P-type ATPase, fungal-type
  • ( TIGR01652 ) phospholipid-translocating P-type ATPase, flippase
  • ( TIGR01488 ) HAD-superfamily hydrolase, subfamily IB (PSPase-like)
  • ( TIGR01494 ) ATPase, P-type (transporting), HAD superfamily,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00372460

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_159190
WormBaseWBGene000094989.997093137033517e-262locus:tat-5 status:Confirmed
UniProt:G5EGE0 protein_id
:CAD92377.1
Tetrahymena borealisEI9_12292.19.997093137033517e-262phospholipid-translocating P-t
ype ATPase, flippase (1079 aa)
OxytrichaContig11298.0.g879.997093137033517e-262haloacid dehalogenase-like hyd
rolase
SGDYIL048W9.997093137033517e-262NEO1 Putative aminophospholipi
d translocase (flippase) invol
ved in endocytosis and vacuola
r biogenesis; localizes to end
osomes and the Golgi aparatus
DictyBaseDDB_G02708703.998941839720987e-159atp9b on chromosome: 1 positio
n 2777615 to 2781943

General Information

Paragraph NoGene NameParagraph Text
19FLP11,
FLP18,
FLP17,
FLP8,
FLP16,
FLP15,
FLP14,
FLP6,
FLP13,
FLP10,
FLP2,
FLP1,
DNF1 ,
FLP9,
FLP12,
FLP4,
FLP7,
FLP5,
FLP19
The phospholipid flippase family of genes in Tetrahymena contains 20 members, FLP1-FLP20. Preliminary studies show that many of these genes are differentially regulated in response to temperature and/or the presence of a polycyclic aromatic hydrocarbon (pyrene).

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00372460(coding)
ATGAACCAATTATAAAATAGGAAAGATTCAGAGAATTCTGATCTAGATGAGCCATTAATT
AAAAAATAACCTGCGGCTCCAGCCCAGACTGTTCCTAACCCGGCTGAAGAGCACCTTCTT
ATTTACATGGATGGCAGAATATCTCCTGAAACATATTCACCAAATGTCATTAACAATTAA
AAGTATACAGTACAAAACTTTATTCCCAAAGTTTTGTATAACTAGTTCAAGTACTTCTTC
AATTTATTCTTTTTACTGATTGCACTTTCTCAATTCATTCCTCAGTTTAAAGTCGGTTTT
CTCTTTTCCTATGTTGCACCATTAGTTATGGTACTCACATTTACTATGTGCAACGAAGCT
TACGATGACTATAAGAGATACATAAGAGATACCGAATAAAATACTTAAAAGTATAATGTA
AGAAGGGATGGAAGCTCTTATGAAATCAATGCAAGTGAGCTCAAGCCTGGAGATTTAGTT
GAGGTTAGAGCCAACTAAAGAGTACCTGCAGATTTGGTTTTAATTTGTACTTCTGAAGAA
GATGGTACAGTTTTCATCAGAACAGATTAATTAGATGGTGAAACTGATTGGAAATTAAGA
AAATCAATTAAATATACATAGAAACGTAAAAACTATGATTTATAAAAGTTAAATGGTTGC
GTTCGTGCAGATATTCCCAGAATAGATATTTACAAGTTCTTTGGTTTATTCAAATCCACT
GATACTGACTCTGAAAATAAAGATGAGTACCGTGAACCTCTCTCTCTTGAAAACACACTC
TGGGCTAATACTTATGTTGCTGCTGGTGAAGTTGTTGGTTTGGTTGTTTATACAGGTAAA
GATACTCGTTCTGTCATGAATACCAGAGAATCTAGATATAAATTTGGTTTGGTTGACTAT
GAACTTAATGGCTTGACTAAAACTTGTTTCGGATTAATGTGTTTGCTTGCCTTTATGATC
ATTCTTGCTAAAGGATTTGGTCCTAATTGGTTCATTCAATATTTCCGTTTCGTTCTATTA
CTTTCTAGTATTATTCCTATTTCCTTACGTGTTAATTTGGATGCTGCTAAAATTATTTTT
TCTTATAAGATCAACAACGATCCTTAAATCCCAGGTACTATCACTCGTAATTCTTAAATT
CCTGAAGAATTGGGAAGAGTTTAGTATATTTTATCTGATAAAACTGGCACTTTAACTTAA
AATGATATGATTTTCCGTAAACTCTGCTTAGAAAGTACCTTATTTACTGATAAAAATCTT
AAGAAATTATCTAATATAGTTAAGAAGTAATGCTATGTAGTAAATGGTCCTTGTTCTGAC
GTTGCAGAAAAAGTTAAAGCAGATTAACAATCTGGTAATCGTCGTCGTATGTATCGTCGT
GATCGTGAATTAGTTGTTAGAGATATCATAACAGCTTTAGCCGTTTGCCATAATGTTACT
CCAGTTATTGATTAAGGATAGAAAGTTTATCAAGCTTCATCTCCAGATGAGGTTGCTTTG
GTAAAAATAGCTGAAGATCTTAAAATGGAATTGGTTAAACGTGACTAGTCAAAAATTGTA
ATCAAAAATGCAAAGGGAGATGAGGAAACTTTTTTAGTTTTGGCAAATTTCCCTTTCACA
AGTGAGTCAAAGCGTATGGGTATTATTCTCAGACATTAATCAACTAATAGGGTCATTTTT
TACTTGAAGGGTGCTGATTCTATAATGAAAAGTAGAGTACCTGAAGTTTAAAGAGGTTTC
TTATTAGATGAGTGTGAAAATCTTGCTAGAGAAGGTCTTCGTACTTTAGTCATCACTCAA
AAGTATTTAACTGAAGAAGAGTATTAAGAATGGAGTAGAAAGTACTAAGAAGCACAAAGT
AACGATAATTTCGGTAACAGAGAAGAAAAAATTCGTGAAGTTGTTGATTAACTTGAATTA
AATATGGAATTCTTGGGTATCACTGGTGTTGAAGATAAGTTATAAGAAGATGTAGCTACA
ACAATTTCAAGTTTAAGAAGAGGTGGTATCAATGTATGGATGCTTACAGGTGATAAGGTT
GAAACTGCTACTTGTATTGCTATATCTACTGGATTAAAGAGTATCACTGAAGATATTTTT
ATCATAAGAGATGTTGAAGATGAAATGATTTTAACTCAAAAGCTTAATGAATACGGAAAA
AAGAATGCTGTCCTTGTTATCGATGGTGTCTCTTTATAAACTGCCCTCACTCATAGAGAA
AAATTATTCTTCGAGGTAGCTACTAGTGCTCCAAGTGTTGTTTGTTGTAGATGCTCTCCC
ACTTAAAAAGCAGTAGTTACCGATGGTATTAAGAATCACACAAACAAAATTACATTAGCT
ATAGGTGATGGTGGCAACGATGTTGGTATGATTTAAAGCGCTCACGTTGGTATTGGTATT
GTAGGCAAAGAAGGAAAATAAGCTGCTCTTGCTTCAGATTACTCAATTTTGAAATTTAAA
TATCTTGCCAAATTACTTTTGTTCCATGGTAGACTTAATTACAAGAGAACTGCAGTTATG
AGTCAATTCGTTATTCACAGAGGTACTATTATTTCAATCATGTAGACAATATTTAACTGT
ATCTTTTACTTTGTCCCTATTCCTTTGTACAATGGTTTCTTGATGCTTGGTTATACTACT
GTTTATACTTTACTTCCTGTATTTTGCCTTCTTTTGGATCAAGATGTTAATCCTAAGGCT
GCTTTGGAGTATCCTGAGCTGTACAAAACATTGCAAAGTGGTAGAGATTTAAATCTTAAA
ACTTTCTTGATGTGGGTCTTTAAGAGTATCTATTAAGGAATGATCATCATGGCTCTTGCC
TTCACACTTTTTGATAATAGTTATTTCCATATTGTTACAATTACATTCTCTACATTGGTA
TTATGTGAAATTCTAAATGTCCATTCTGAGCTTAATAGAATCACTTGGATGACAGTTCTT
TTCACTATTGGAACAATTGCCTTTTACGTTTTATCAGTTTATTTCATAAATGAATACTTA
GATATGAAGGCTATCAATATTGATTTTGCTATAAATATTGTAATCATATCTGCTATTTGC
TGGCTACCATTCTGGGCTGTAAAGAAATACTATAGTATGGTTTAACCTGATGACTATTAG
ACTATCATGAAGCTTGTAAGAAAATAAGAAGCTGAAGAAAAAATCTTTGGTGAAAATGTT
AACGATGAAATGAGACCCTTAGAAGACTTTGGTCCTGCTAAGGATTAGTCTTGA


>TTHERM_00372460(protein)
MNQLQNRKDSENSDLDEPLIKKQPAAPAQTVPNPAEEHLLIYMDGRISPETYSPNVINNQ
KYTVQNFIPKVLYNQFKYFFNLFFLLIALSQFIPQFKVGFLFSYVAPLVMVLTFTMCNEA
YDDYKRYIRDTEQNTQKYNVRRDGSSYEINASELKPGDLVEVRANQRVPADLVLICTSEE
DGTVFIRTDQLDGETDWKLRKSIKYTQKRKNYDLQKLNGCVRADIPRIDIYKFFGLFKST
DTDSENKDEYREPLSLENTLWANTYVAAGEVVGLVVYTGKDTRSVMNTRESRYKFGLVDY
ELNGLTKTCFGLMCLLAFMIILAKGFGPNWFIQYFRFVLLLSSIIPISLRVNLDAAKIIF
SYKINNDPQIPGTITRNSQIPEELGRVQYILSDKTGTLTQNDMIFRKLCLESTLFTDKNL
KKLSNIVKKQCYVVNGPCSDVAEKVKADQQSGNRRRMYRRDRELVVRDIITALAVCHNVT
PVIDQGQKVYQASSPDEVALVKIAEDLKMELVKRDQSKIVIKNAKGDEETFLVLANFPFT
SESKRMGIILRHQSTNRVIFYLKGADSIMKSRVPEVQRGFLLDECENLAREGLRTLVITQ
KYLTEEEYQEWSRKYQEAQSNDNFGNREEKIREVVDQLELNMEFLGITGVEDKLQEDVAT
TISSLRRGGINVWMLTGDKVETATCIAISTGLKSITEDIFIIRDVEDEMILTQKLNEYGK
KNAVLVIDGVSLQTALTHREKLFFEVATSAPSVVCCRCSPTQKAVVTDGIKNHTNKITLA
IGDGGNDVGMIQSAHVGIGIVGKEGKQAALASDYSILKFKYLAKLLLFHGRLNYKRTAVM
SQFVIHRGTIISIMQTIFNCIFYFVPIPLYNGFLMLGYTTVYTLLPVFCLLLDQDVNPKA
ALEYPELYKTLQSGRDLNLKTFLMWVFKSIYQGMIIMALAFTLFDNSYFHIVTITFSTLV
LCEILNVHSELNRITWMTVLFTIGTIAFYVLSVYFINEYLDMKAINIDFAINIVIISAIC
WLPFWAVKKYYSMVQPDDYQTIMKLVRKQEAEEKIFGENVNDEMRPLEDFGPAKDQS


>TTHERM_00372460(gene)
ATGAACCAATTATAAAATAGGAAAGATTCAGAGAATTCTGATCTAGATGAGCCATTAATT
AAAAAATAACCTGCGGCTCCAGCCCAGACTGTTCCTAACCCGGCTGAAGAGCACCTTCTT
ATTTACATGGATGGCAGAATATCTCCTGAAACATATTCACCAAATGTCATTAACAATTAA
AAGTATACAGTACAAAACTTTATTCCCAAAGTTTTGTATAACTAGTTCAAGTACTTCTTC
AATTTATTCTTTTTACTGATTGCACTTTCTCAATTCATTCCTCAGTTTAAAGTCGGTTTT
CTCTTTTCCTATGTTGCACCATTAGTTATGGTACTCACATTTACTATGTGCAACGAAGCT
TACGATGACTATAAGAGATACATAAGAGATACCGAATAAAATACTTAAAAGTATAATGTA
AGAAGGGATGGAAGCTCTTATGAAATCAATGCAAGTGAGCTCAAGCCTGGAGATTTAGTT
GAGGTATCCATAGTTTGTTTTGATTTGATTTATTTGAATTTTTATTTTTAAAAAGGATAT
ACAAACAAAGCGTTTTAATAGGTTTTATATAATTTTGCATTGCTAATATCCATAAATGCA
AGCTTATAAGTCAATAAACCTTTTGAAGATTTCATTTTGAAAATATTTTTGATATAATCT
TATTTTTATAAATTTTAAACTGCAAATAGAATTTTTTTATATTACTTAAACTAATTTAGT
TTGATGTCTATTATCAAAATAATAAAATTGAAAATAAACATAAGTAAACTGGTAAATAAA
AAGATATAAAATCTTGATTAAATTATTTATTTATTAATTCATTAATAAATCTAGTTTATT
ATTTAAATACCAGTTGTTCTAATGATTTTAAAATTAAAGTCTATACTCCCACAATTAATT
AGTAACCATAAGCATTTTTTTGAATATCTATCAATCTTAAAATCTGTCTATCTTCAAATT
AAAGATTATTTTAAAGAGCAAATTTTACAATTAAGATTTAATGATTAGACGACACTTCCA
AAAACACAAAACAAACTTTAATTTTTAAATATTAAATTGAATTTTAAACTTTAAACAAAT
AAATTAAATTTATTTTTTAATAATTAATAGGTTAGAGCCAACTAAAGAGTACCTGCAGAT
TTGGTTTTAATTTGTACTTCTGAAGAAGATGGTACAGTTTTCATCAGAACAGATTAATTA
GATGGTGAAACTGATTGGAAATTAAGAAAATCAATTAAATATACATAGAAACGTAAAAAC
TATGATTTATAAAAGTTAAATGGTTGCGTTCGTGCAGATATTCCCAGAATAGATATTTAC
AAGTTCTTTGGTTTATTCAAATCCACTGATACTGACTCTGAAAATAAAGATGAGTACCGT
GAACCTCTCTCTCTTGAAAACACACTCTGGGCTAATACTTATGTTGCTGCTGGTGAAGTT
GTTGGTTTGGTTGTTTATACAGGTAAAGATACTCGTTCTGTCATGAATACCAGAGAATCT
AGATATAAATTTGGTTTGGTTGACTATGAACTTAATGGCTTGACTAAAACTTGTTTCGGA
TTAATGTGTTTGCTTGCCTTTATGATCATTCTTGCTAAAGGATTTGGTCCTAATTGGTTC
ATTCAATATTTCCGTTTCGTTCTATTACTTTCTAGTATTATTCCTATTTCCTTACGTGTT
AATTTGGATGCTGCTAAAATTATTTTTTCTTATAAGATCAACAACGATCCTTAAATCCCA
GGTACTATCACTCGTAATTCTTAAATTCCTGAAGAATTGGGAAGAGTTTAGTATATTTTA
TCTGATAAAACTGGCACTTTAACTTAAAATGATATGATTTTCCGTAAACTCTGCTTAGAA
AGTACCTTATTTACTGATAAAAATCTTAAGAAATTATCTAATATAGTTAAGAAGTAATGC
TATGTAGTAAATGGTCCTTGTTCTGACGTTGCAGAAAAAGTTAAAGCAGATTAACAATCT
GGTAATCGTCGTCGTATGTATCGTCGTGATCGTGAATTAGTTGTTAGAGATATCATAACA
GCTTTAGCCGTTTGCCATAATGTTACTCCAGTTATTGATTAAGGATAGAAAGTTTATCAA
GCTTCATCTCCAGATGAGGTTGCTTTGGTAAAAATAGCTGAAGATCTTAAAATGGAATTG
GTTAAACGTGACTAGTCAAAAATTGTAATCAAAAATGCAAAGGGAGATGAGGAAACTTTT
TTAGTTTTGGCAAATTTCCCTTTCACAAGTGAGTCAAAGCGTATGGGTATTATTCTCAGA
CATTAATCAACTAATAGGGTCATTTTTTACTTGAAGGGTGCTGATTCTATAATGAAAAGT
AGAGTACCTGAAGTTTAAAGAGGTTTCTTATTAGATGAGTGTGAAAATCTTGCTAGAGAA
GGTCTTCGTACTTTAGTCATCACTCAAAAGTATTTAACTGAAGAAGAGTATTAAGAATGG
AGTAGAAAGTACTAAGAAGCACAAAGTAACGATAATTTCGGTAACAGAGAAGAAAAAATT
CGTGAAGTTGTTGATTAACTTGAATTAAATATGGAATTCTTGGGTATCACGTAAAGTGTT
TTAATCATTATAAAATATTTCAAACAAAACATCATCTTTTTTTAAAAAAAATATTCAATT
ATTAAATATTCATTAATAAATAAATAGTGGTGTTGAAGATAAGTTATAAGAAGATGTAGC
TACAACAATTTCAAGTTTAAGAAGAGGTGGTATCAATGTATGGATGCTTACAGGTGATAA
GGTAATAATTATAAAATATTAGTAAAATAAAGAAATTAATAAATCAAATAATAATTTTAA
AGGTTGAAACTGCTACTTGTATTGCTATATCTACTGGATTAAAGAGTATCACTGAAGATA
TTTTTATCATAAGAGATGTTGAAGATGAAATGATTTTAACTCAAAAGCTTAATGAATACG
GAAAAAAGAATGCTGTCCTTGTTATCGATGGTGTCTCTTTATAAACTGCCCTCACTCATA
GAGAAAAATTATTCTTCGAGGTAGCTACTAGTGCTCCAAGTGTTGTTTGTTGTAGATGCT
CTCCCACTTAAAAAGCAGTAGTTACCGATGGTATTAAGAATCACACAAACAAAATTACAT
TAGCTATAGGTGATGGTGGCAACGATGTTGGTATGATTTAAAGCGCTCACGTTGGTATTG
GTATTGTAGGCAAAGAAGGTAAACTTTTTAAAATATTAAATTTGTAAAATTTTTAATGTT
TTTTCTTTAATTGTTTTACAGGAAAATAAGCTGCTCTTGCTTCAGATTACTCAATTTTGA
AATTTAAATATCTTGCCAAATTACTTTTGTTCCATGGTAGACTTAATTACAAGAGAACTG
CAGTTATGAGTCAATTCGTTATTCACAGGTAAATTAGCAAAATATTCTTACAGAAACCAA
ACTCATTTACAATATCATTTCAACTTTCTAATTCAACTGATAAAATTATTTTATATAAAC
TAATTAATTTTTAAAAAAATAGAGGTACTATTATTTCAATCATGTAGACAATATTTAACT
GTATCTTTTACTTTGTCCCTATTCCTTTGTACAATGGTTTCTTGATGCTTGGTTATACTA
CTGTTTATACTTTACTTCCTGTATTTTGCCTTCTTTTGGATCAAGATGTTAATCCTAAGG
CTGCTTTGGAGTATCCTGAGCTGTACAAAACATTGCAAAGTGGTAGAGATTTAAATCTTA
AAACTTTCTTGATGTGGGTCTTTAAGAGTATCTATTAAGGAATGATCATCATGGCTCTTG
CCTTCACACTTTTTGATAATAGTTATTTCCATATTGTTACAATTACATTCTCTACATTGG
TATTATGTGAAATTCTAAATGTCCATTCTGAGCTTAATAGAATCACTTGGATGACAGTTC
TTTTCACTATTGGAACAATTGCCTTTTACGTTTTATCAGTTTATTTCATAAATGAATACT
TAGATATGAAGGCTATCAATATTGATTTTGCTATAAATATTGTAATCATATCTGCTATTT
GCTGGCTACCATTCTGGGCTGTAAAGAAATACTATAGTATGGTTTAACCTGATGACTATT
AGACTATCATGAAGCTTGTAAGAAAATAAGAAGCTGAAGAAAAAATCTTTGGTGAAAATG
TTAACGATGAAATGAGACCCTTAGAAGACTTTGGTCCTGCTAAGGATTAGTCTTGA