Identifiers and Description

Gene Model Identifier

TTHERM_00227040

Standard Name

FKB1 (FK506 Binding protein 1)

Aliases

PreTt12514 | 19.m00306

Description

Putative 12-kD FK506 binding protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00254 ) peptidyl-prolyl cis-trans isomerase, FKBP-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00227040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05520.17.000324531217758e-70FKBP12 (111 aa)
SGDYNL135C1.999683289470905e-41FPR1 Peptidyl-prolyl cis-trans
isomerase (PPIase), binds to
the drugs FK506 and rapamycin;
also binds to the nonhistone
chromatin binding protein Hmo1
p and may regulate its assembl
y or function
OxytrichaContig18830.0.g954.9998290395614495e-40FKBP-type peptidyl-prolyl cis-
trans isomerase
WormBaseWBGene000014273.9990760533890984e-36locus:fkb-2 Peptidyl-prolyl
cis-trans isomerase status:C
onfirmed UniProt:Q9U2Q8 pr
otein_id:CAA22330.1
DictyBaseDDB_G02752273.000842737734004e-34DDB_G0275227 on chromosome: 2
position 4935740 to 4936447
Stentor CoeruleusSteCoe_241134.248354255291589e-18

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00227040(coding)
ATGTCTGAATTATAAGTAGTTACCAAGAAACCAGGTGATGGTAAGACTTATCCTAAAAAG
GGATAAACCGTCACAGTCCACTACGTCGGTACCTTCACTGATGGTAGAAAGTTTGACTCT
TCTAGAGACAGAAAGGAACCTTTCTAATTCAACATCGGAAGCGGTTAAGTTATTAAAGGT
TGGGATGAAGGTGTCGCTAGAATGTCCCTCGGTGAAGTTGCTGTTATCACTTGTCCTTAC
TAATACGCTTATGGTGAAAAGGGTTATCCTGGTGTCATCCCTCCTAAGGCCACCTTAGTT
TTCGAAGTTGAACTCCTCGGTATGTAATGA


>TTHERM_00227040(protein)
MSELQVVTKKPGDGKTYPKKGQTVTVHYVGTFTDGRKFDSSRDRKEPFQFNIGSGQVIKG
WDEGVARMSLGEVAVITCPYQYAYGEKGYPGVIPPKATLVFEVELLGMQ


>TTHERM_00227040(gene)
ATGTCTGAATTATAAGTAGTTACCAAGAAACCAGGTGATGGTAAGACTTATCCTAAAAAG
GGATAAACCGTCACAGTCCACTACGTCGGTACCTTCACTGATGGTAGAAAGTTTGACTCT
TCTAGAGACAGAAAGGAACCTTTCTAATTCAACATCGGAAGCGGTTAAGTTATTAAAGGT
TGGGATGAAGGTGTCGCTAGAATGTCCCTCGGTGAAGTTGCTGTTATCACTTGTCCTTAC
TAATACGCTTATGGTGAAAAGGGTTATCCTGGTGTCATCCCTCCTAAGGCCACCTTAGTT
TTCGAAGTTGAACTCCTCGGTATGTAATGA