Identifiers and Description

Gene Model Identifier

TTHERM_01046850

Standard Name

FIMP1 (FACT-interacting mysterious protein 1)

Aliases

PreTt05032 | 210.m00039

Description

FIMP-1 co-purified with Cet1 subunit of the FACT complex in affinity purification followed by mass spectrometry experiments.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.8%

TetraMine Data

TTHERM_01046850

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14078.17.001220308967917e-48hypothetical protein (540 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:30796450: Ashraf K, Nabeel-Shah S, Garg J, Saettone A, Derynck J, Gingras AC, Lambert JP, Pearlman RE, Fillingham J (2019) Proteomic analysis of histones H2A/H2B and variant Hv1 in Tetrahymena thermophila reveals an ancient network of chaperones. Molecular biology and evolution ( ):

Sequences

>TTHERM_01046850(coding)
ATGGCCTCCTATGAATAATAATAGCTTGCTTCGTTAATTGGATTAATTTTTGAAAGAAAA
TAACAACACTATGAAGTTCAAAAAGATATGGTTATCAAGTGCAATCAGCTACAGGAGAAG
GCTTGTTAAATAAAGCAACTTTACAATGATATTGCGGAGAAAGATAGAATAAAAAATATA
CTCACGAATCCTCAAGCTTAATTTGATGATGCATAGATAGAACTTCAAAAAATAATAGAG
GAAAAAGTGCAAAAGTAGCAAGAAACAGAAAATTTGCTTAAAAATTTTTTGAAAGCACAC
GAAAAAAAGTTTGATCAAAATTAACCAAATCAAATAAAGGTCAACATAATTAATTTAATC
AGAAATATAAATTTTTTCAAAGAAAACGAATAAGTTTAAGTGTATAAATAGAATGAAAGC
AACCATGTCAATTAAATAATCAGCATGATCTCAAATAAATCTAATTTATGTTCATCTGAA
TTTATCAACAAATTCAAATAGATTGTCAATAAATATTAGTTTATTTTTGATGATCTAAAA
GGAGTTTAAATATACAAAGATGGATTTTAGAAGCCAATCAATTTTGAAGATTTTTCTGAG
TTTTAAATGTCATAAATAAGTAAGTATTCTGATATTATTCATAACGGATAACAGTAAAAT
GTTGAGTAATCTCCTTAAATTAAGTAATTTATGAAGCTAGTTAATTAAAAGTAAGAGTGT
TTGCCAAACTAAATCAAGGAAAAAATCTAAAAAGTGTATTTAAGTATATCCCCTTTTTTA
GAAGGAGTGGATTTAACAATGCCTTAGAATATAAACTACCTATTGGAATATCCCTTTATC
AAAAGCAATTTTTATAACTCATAATAGGATCTACAAATTATAGCTCTTGGAGACTAAAGT
ATTCAATTCACGAAAACCAGTTAGGAGGATGATTACTACAACAACATTATTTCAACATTA
TTTATTGATAAAAACATTACCTATTCAGTCATTTTTGAAGTTTCTTACTAAAATCAGGAC
CATTTTTCATTTTTCATAGGCTTGACAACCAAAGGAAATACAGATCATTTATATAACGAA
AAGTTATCATTTTGTATAGCTTCTAAGGATCTTAATAATGGCTATGGAATTGATTGTGTA
AAGCAAGGTGATAAAATGAGATTAAGGAAAAATTTCAAATAATTCTAATTTAAAATTAAC
CTTTCTGAAGGATTAGTTGAAGTGTCTGACTACCCAAATAGCTACAACATTATCAAACTA
GATGAAAATAAAAAAAGTACTATCCTTGAAAAGTCAGGCTTATATTAAATAGGTTTTTCA
ATAAGAAGCAAGTCAGATTCTATAATAATAAAATAGTTAAATGTCAGCATTGATTGA


>TTHERM_01046850(protein)
MASYEQQQLASLIGLIFERKQQHYEVQKDMVIKCNQLQEKACQIKQLYNDIAEKDRIKNI
LTNPQAQFDDAQIELQKIIEEKVQKQQETENLLKNFLKAHEKKFDQNQPNQIKVNIINLI
RNINFFKENEQVQVYKQNESNHVNQIISMISNKSNLCSSEFINKFKQIVNKYQFIFDDLK
GVQIYKDGFQKPINFEDFSEFQMSQISKYSDIIHNGQQQNVEQSPQIKQFMKLVNQKQEC
LPNQIKEKIQKVYLSISPFLEGVDLTMPQNINYLLEYPFIKSNFYNSQQDLQIIALGDQS
IQFTKTSQEDDYYNNIISTLFIDKNITYSVIFEVSYQNQDHFSFFIGLTTKGNTDHLYNE
KLSFCIASKDLNNGYGIDCVKQGDKMRLRKNFKQFQFKINLSEGLVEVSDYPNSYNIIKL
DENKKSTILEKSGLYQIGFSIRSKSDSIIIKQLNVSID


>TTHERM_01046850(gene)
ATGGCCTCCTATGAATAATAATAGCTTGCTTCGTTAATTGGATTAATTTTTGAAAGAAAA
TAACAACACTGTAAATTAAACACAAATTATTTAACAATATTTTGATAGCTTGAAGTAAGA
AGTAAATAAATTTATAGATGAAGTTCAAAAAGATATGGTTATCAAGTGCAATCAGCTACA
GGAGAAGGCTTGTTAAATAAAGCAACTTTACAATGATATTGCGGAGAAAGATAGAATAAA
AAATATACTCACGAATCCTCAAGCTTAATTTGATGATGCATAGATAGAACTTCAAAAAAT
AATAGAGGAAAAAGTGCAAAAGTAGCAAGAAACAGAAAATTTGCTTAAAAATTTTTTGAA
AGCACACGAAAAAAAGTTTGATCAAAATTAACCAAATCAAATAAAGGTCAACATAATTAA
TTTAATCAGAAATATAAATTTTTTCAAAGAAAACGAATAAGTTTAAGTGTATAAATAGAA
TGAAAGCAACCATGTCAATTAAATAATCAGCATGATCTCAAATAAATCTAATTTATGTTC
ATCTGAATTTATCAACAAATTCAAATAGATTGTCAATAAATATTAGTTTATTTTTGATGA
TCTAAAAGGAGTTTAAATATACAAAGATGGATTTTAGAAGCCAATCAATTTTGAAGATTT
TTCTGAGTTTTAAATGTCATAAATAAGTAAGTATTCTGATATTATTCATAACGGATAACA
GTAAAATGTTGAGTAATCTCCTTAAATTAAGTAATTTATGAAGCTAGTTAATTAAAAGTA
AGAGTGTTTGCCAAACTAAATCAAGGAAAAAATCTAAAAAGTGTATTTAAGTATATCCCC
TTTTTTAGAAGGAGTGGATTTAACAATGCCTTAGAATATAAACTACCTATTGGAATATCC
CTTTATCAAAAGCAATTTTTATAACTCATAATAGGATCTACAAATTATAGCTCTTGGAGA
CTAAAGTATTCAATTCACGAAAACCAGTTAGGAGGATGATTACTACAACAACATTATTTC
AACATTATTTATTGATAAAAACATTACCTATTCAGTCATTTTTGAAGTTTCTTACTAAAA
TCAGGACCATTTTTCATTTTTCATAGGCTTGACAACCAAAGGAAATACAGATCATTTATA
TAACGAAAAGTTATCATTTTGTATAGCTTCTAAGGATCTTAATAATGGCTATGGAATTGA
TTGTGTAAAGCAAGGTGATAAAATGAGATTAAGGAAAAATTTCAAATAATTCTAATTTAA
AATTAACCTTTCTGAAGGATTAGTTGAAGTGTCTGACTACCCAAATAGCTACAACATTAT
CAAACTAGATGAAAATAAAAAAAGTACTATCCTTGAAAAGTCAGGCTTATATTAAATAGG
TTTTTCAATAAGAAGCAAGTCAGATTCTATAATAATAAAATAGTTAAATGTCAGCATTGA
TTGA