Identifiers and Description

Gene Model Identifier

TTHERM_00136510

Standard Name

FIM1 (Fimbrin, actin filament bundling protein; contains 2 alpha-actinin-type binding domains, but lacks E)

Aliases

PreTt24376 | 10.m00425 | 3698.m00144

Description

fimbrin-like 71 K protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00307 ) Calponin homology (CH) domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00136510

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05818.19.997093137033517e-262fimbrin-like 71 K protein (523
aa)
OxytrichaContig10286.0.1.g441.999872053281847e-142Calponin homology (CH) domain
SGDYDR129C2.0000211193600847e-137SAC6 Fimbrin, actin-bundling p
rotein; cooperates with Scp1p
(calponin/transgelin) in the o
rganization and maintenance of
the actin cytoskeleton
DictyBaseDDB_G02778553.0001046824819247e-131fimA on chromosome: 3 position
187950 to 189871
Stentor CoeruleusSteCoe_43632.001470128041443e-75
WormBaseWBGene000224255.9981191891941984e-64locus:plst-1 status:Partiall
y_confirmed UniProt:U4PBU8
protein_id:CDH93209.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:14607987: Shirayama S, Numata O (2003) Tetrahymena fimbrin localized in the division furrow bundles actin filaments in a calcium-independent manner. Journal of biochemistry 134(4):591-8
  2. Ref:11942614: Numata O, Gonda K (2001) Determination of division plane and organization of contractile ring in Tetrahymena. Cell structure and function 26(6):593-601
  3. Ref:10816251: Numata O, Gonda K, Watanabe A, Kurasawa Y (2000) Cytokinesis in Tetrahymena: determination of division plane and organization of contractile ring. Microscopy research and technique 49(2):127-35
  4. Ref:10731670: Watanabe A, Yonemura I, Gonda K, Numata O (2000) Cloning and sequencing of the gene for a Tetrahymena fimbrin-like protein. Journal of biochemistry 127(1):85-94
  5. Ref:9538250: Watanabe A, Kurasawa Y, Watanabe Y, Numata O (1998) A new Tetrahymena actin-binding protein is localized in the division furrow. Journal of biochemistry 123(4):607-13

Sequences

>TTHERM_00136510(coding)
ATGGATACCTTAAAGACTGCTGTAAAGACTAATGTCGAAGCTAAATAAAGCGACACAAAT
GCTATTCACTCATTTACTTAAGATGAAGTTAATGCTTACTGCGAACATATTAACTACTAT
CTTTCTGATGATGCTGACCTCAAAGAATTATTGCCAATTGATCCTTAAAGCAATAAGATT
TTTGAAGCTGTTGGAGATGGTGTCTTGCTTTGCAAATTAATCAACAAAGCCACTCCTGGT
ACTATTGACCCTAGAGCCATCAACACCAAGAACCTTAACATCTTTAAGAAAAATGAAAAC
TTAACCTTAGCTATAGCTTCTGCTAGAGCAATTGGCTGTGTTTGCGTTAATATTACAAAC
AATAGCATTATAGATAAGAGAGAACATATTATTTTGGGTCTTGTTTGGTAGATTATCAAG
GCTTAAATGTTGTTTAAGATTGACTTGAAAAACCACCCTTATTTGATTAGACTTAAAAAG
GAAGAAGAAGAAATTAGTGATCTTCTTAAACTCCCTAAAGAAGAACTTTTGATCCGTTGG
TTCAATTACCATTTAGAAAATGCTAAGCACTCAACTAAGATTAATAACTTTTCTAAGGAT
GTTTCCTCAGGTACTGAATACACAGTTTTACTCAACCAAATTGCTCCTGAAAAGTGCAAC
AAAGACGGATTAAATTTAGAACACCTTGAAAGATGCAAGAAGGTTATTAATGATTCTAAA
CTTTTGGGAGTACCTCCTTGTATTAAGCCTTCTGATATTGTAAATGGAAATCAAAAGCTT
AACTTGATTTTCTGTGCTCACTTATTCAACAATTGCCCTGGTTTAACTCCTACTGAACAA
GAAAAAATTGATGCTGCTGGCATGATAGATGATGATAACGATCCTGAAGCTTCTCGTGAA
GAAAGAGTTTTCAGAATGTGGATGAACTCTTTAAATATTGAAGATGTTTATCTTAACAAT
ATGATTCAAGATTTAAGAGATGGTATCGTTTTATGTAAGATTATGGATAAATTAGCTCCA
GGAAAAGTTGACTTGAAGAAGGTTTCAAATAAAAACTCTAAATTCACTAAAATACAAAAC
GCTAACTACGCAGTATAATTAGCTAAGGATTTACATTTATAAATTGTTGGTATTGGTGGT
ACTGATATTGTAGATGGTAACAAAAAGCTTATCCTTGCTATTGTTTGGTAACTCATGAGA
AAGTAATCATTACAGGTTATTGGTGAATTGAATGAACAAAAATTAGTAGAATGGGGTAAT
AGTAGAATTCCTCAAGATAAACATATAACTGGATTTAAAGATAAATCTCTTAAAAACTCA
CATTTCTTCTTCAAGATTATGGAATCTATTGAACCTAGAGCTATCAATTAGGATTTGATA
ACTCCTGGTGAGACTGATGAAGAAGTCACTAACAATGCTAAATACGCTATCTCTGTTGCT
CGTAAGCTTGGTGCAGCAGTTTTCCTTGTTTGGGAACACATTAGAGACGTCAATCCTAAA
TTTTTAATGACATTTACTGCTTCTCTCTACCACTGTGCTAAAGAATACGAAGGAAAGAAG
GTCTAATGA


>TTHERM_00136510(protein)
MDTLKTAVKTNVEAKQSDTNAIHSFTQDEVNAYCEHINYYLSDDADLKELLPIDPQSNKI
FEAVGDGVLLCKLINKATPGTIDPRAINTKNLNIFKKNENLTLAIASARAIGCVCVNITN
NSIIDKREHIILGLVWQIIKAQMLFKIDLKNHPYLIRLKKEEEEISDLLKLPKEELLIRW
FNYHLENAKHSTKINNFSKDVSSGTEYTVLLNQIAPEKCNKDGLNLEHLERCKKVINDSK
LLGVPPCIKPSDIVNGNQKLNLIFCAHLFNNCPGLTPTEQEKIDAAGMIDDDNDPEASRE
ERVFRMWMNSLNIEDVYLNNMIQDLRDGIVLCKIMDKLAPGKVDLKKVSNKNSKFTKIQN
ANYAVQLAKDLHLQIVGIGGTDIVDGNKKLILAIVWQLMRKQSLQVIGELNEQKLVEWGN
SRIPQDKHITGFKDKSLKNSHFFFKIMESIEPRAINQDLITPGETDEEVTNNAKYAISVA
RKLGAAVFLVWEHIRDVNPKFLMTFTASLYHCAKEYEGKKVQ


>TTHERM_00136510(gene)
ATGGATACCTTAAAGACTGCTGTAAAGACTAATGTCGAAGCTAAATAAAGCGACACAAAT
GCTATTCACTCATTTACTTAAGATGAAGTTAATGCTTACTGCGAACATATTAACTACTAT
CTTTCTGTAATATTATTTTTATATTTTCAAAAGTTTATTCAGTTTTATCAAAAAACTTTA
GGATGATGCTGACCTCAAAGAATTATTGCCAATTGATCCTTAAAGCAATAAGATTTTTGA
AGCTGTTGGAGATGGTGTCTTGCTTTGGTAATTTCACGATTTTTCAAAAATTTGTTATAG
AATTTTATTTTGTTAATTCTATTTAGCAAATTAATCAACAAAGCCACTCCTGGTACTATT
GACCCTAGAGCCATCAACACCAAGAACCTTAACATCTTTAAGAAAAATGTAAACATATTA
AATATTTTGATTGCAAGAAAATTATTTAAAAAATAATCTCAATCAGTCAATAAAAGGAGA
ATTTTAATTCATTCCATTAAATTTATTTTCTTAAAATAGGAAAACTTAACCTTAGCTATA
GCTTCTGCTAGAGCAATTGGCTGTGTTTGCGTTAATATTACAAACAATAGCATTATAGAT
AAGAGAGAACATATTATTTTGGGTCTTGTTTGGTAGATTATCAAGGTATTTATTTTATTT
TTGGATTTTTTTTTCTTAAATGTTTGTTTGTTTATTAAATATGTGAATATTTCAGACCTT
CAATATGTTTTTTATAATAAAAAGGCTTAAATGTTGTTTAAGATTGACTTGAAAAACCAC
CCTTATTTGATTAGACTTAAAAAGGAAGAAGAAGAAATTAGTGATCTTCTTAAACTCCCT
AAAGAAGAACTTTTGATCCGTTGGTTCAATTACCATTTAGAAAATGCTAAGCACTCAACT
AAGATTAATAACTTTTCTAAGGATGTTTCCTCAGGTATTTGAAATGAGCTTATTGAATAT
TAATTAAGGCATTTATATATCCGAAAAAAAATTTTTTATAAATAGAATAAGAAAAATAAT
TAATTTTATTTTTAAATTAAATTAGGTACTGAATACACAGTTTTACTCAACCAAATTGCT
CCTGAAAAGTGCAACAAAGACGGATTAAATTTAGAACACCTTGAAAGATGCAAGAAGGTT
ATTAATGATTCTAAACTTTTGGGAGTACCTCCTTGTATTAAGCCTTCTGATATTGTAAAT
GGAAATCAAAAGCTTAACTTGATTTTCTGTGCTCACTTATTCAACAATTGCCCTGGTTTA
ACTCCTACTGAACAAGAAAAAATTGATGCTGCTGGCATGATAGATGATGATAACGATCCT
GAAGCTTCTCGTGAAGAAAGAGGTAAATAAGAAATTTATTAAAAATTCAGATTAAATTCT
TATTTTAACTCGCATACACTGAGCATTTGAATTTAAGTTTAATTTCTGAAAAAAGATTTT
ATATATCTTATACAAATATTTAGCCCATATTATCAATATCAGTTTAGTTTTTAAAGAAAA
GTAATTAACTAAATCAAAGATATTATTTAAGATTACTGGATAGGAAAAGATTGCTATGTA
ATTAATGGAAAAATAAGCTATCTTAATAAAATTTATCTCTATATCTTTATACCGATCAGT
CAAATAATTAAATGTTAATTTCACTGAGAAAAAAACTTTTTTGAAGAATAAAAATAATTA
ACTTTTTTGGATTCATTTAAAATGAAATTAATGGTTTTAAATTTCAATAATTTATCAGTA
AAAATTTGAAAAAGTTAATTTTATCCTAAAATTTTATTCTTTTTATATCAAATTTCTATT
TTAAGGTATGGTATTATATCATTTTTAATAAAAAATCTATCTATACATAGTTTTCAGAAT
GTGGATGAACTCTTTAAATATTGAAGATGTTTATCTTAACAATATGATTCAAGATTTAAG
AGATGGTATCGTTTTATGTAAGATTATGGATAAATTAGCTCCAGGAAAAGTTGACTTGAA
GAAGGTTTCAAATAAAGTAAAAAATTGAATGAATTTTCTAAAAGTTTATTTTAAATTTAA
TTAATTTATTTCTTTATTAAATTAAAAATAGAACTCTAAATTCACTAAAATACAAAACGC
TAACTACGCAGTATAATTAGCTAAGGATTTACATTTATAAATTGTTGGTATTGGTGGTAC
TGATATTGTAGATGGTAACAAAAAGCTTATCCTTGCTATTGTTTGGTAACTCATGAGAAA
GTAATCATTACAGGTAATAAACAATAAGCAAATTTTAATACAAAAAATCTATCAAAAATT
ATATCTGATAGCTTATTCATTCATTAATATTATAAATAGTAGTTAAAGGCGTTTTGAATT
TTAATTTAATAATAGGTTATTGGTGAATTGAATGAACAAAAATTAGTAGAATGGGGTAAT
AGTAGAATTCCTCAAGATAAACATATAACTGGATTTAAAGATAAATCTCTTAAAAACTCA
CATTTCTTCTTCAAGATTATGGAATCTATTGAACCTAGAGCTATCAATTAGGATTTGATA
ACTCCTGGTGAGACTGATGAAGAAGTCACTAACAATGCTAAATACGCTATCTCTGTTGCT
CGTAAGCTTGGTGCAGCAGTTTTCCTTGTTTGGGAACACATTAGAGACGTAAAATTAAAA
ATCAAATCTTATTATTATATAATAAATTATAATTCATTTTATAAAATAGGTCAATCCTAA
ATTTTTAATGACATTTACTGCTTCTCTCTACCACTGTGCTAAAGAATACGAAGGAAAGAA
GGTCTAATGA