Identifiers and Description

Gene Model Identifier

TTHERM_00138080

Standard Name

FIB1 (FIBrillarin 1)

Aliases

PreTt24434 | PreTt24435 | 10.m00484 | FIB | 3698.m00201

Description

Fibrillarin; essential protein localized to nucleoli in the macronucleus of vegetative cells; involved in rRNA processing; associates with U3 snoRNA

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01269 ) Fibrillarin
  • ( PF08241 ) methyltransferase domain
  • ( PF01391 ) Collagen triple helix repeat (20
  • ( PF08704 ) tRNA methyltransferase complex GCD14 subunit
  • ( TIGR00080 ) protein-L-isoaspartate O-methyltransferase
  • ( TIGR00438 ) ribosomal RNA large subunit methyltransferase
  • ( PF01135 ) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00138080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05872.11.9994249217050915e-157fibrillarin (1203 aa)
WormBaseWBGene000014233.999284652801983e-113locus:fib-1 rRNA 2-O-methylt
ransferase fibrillarin statu
s:Confirmed UniProt:Q22053
protein_id:CAB01657.1
OxytrichaContig11749.0.g1176.001115222296727e-111Fibrillarin
DictyBaseDDB_G02698782.998733531465523e-108fbl on chromosome: 1 position
3783828 to 3785196
SGDYDL014W1.999745369828301e-106NOP1 Nucleolar protein, compon
ent of the small subunit proce
ssome complex, which is requir
ed for processing of pre-18S r
RNA; has similarity to mammali
an fibrillarin
Stentor CoeruleusSteCoe_349083.392270193026015e-47

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:9201715: David E, McNeil JB, Basile V, Pearlman RE (1997) An unusual fibrillarin gene and protein: structure and functional implications. Molecular biology of the cell 8(6):1051-61

Sequences

>TTHERM_00138080(protein)
MGKDFKSGGGNAGGKPFNKGPGGPGGRPFNKGPGGPGGPGGKFGGGRPGGPGGKFGAKGP
RGPKTIIVKHRLEGVFICKGQQEALVTKNFFPGESVYNEKRMSVEENGEKIEYRVWNPYR
SKIAAAVVGGISDIHIKPGSKVLYLGGASGTTVSHVADIVGPTGVVYAVEFSHRSGRDLV
NMAKKRTNVVPIIGDARKPQEYRFLVGMVDVVFADVAQPDQARIMGMNCQYFLKNGGHFL
ISIKACCIDSTNEPAVVFAAEVQKLKEEGLKPEQQLTLEPYERDHAMVLGSYRA


>TTHERM_00138080(coding)
ATGGGTAAAGATTTCAAGTCAGGTGGTGGCAATGCTGGTGGAAAGCCCTTCAATAAAGGT
CCTGGAGGTCCTGGTGGAAGACCCTTCAATAAGGGTCCTGGTGGTCCCGGTGGTCCTGGT
GGCAAATTCGGTGGTGGCAGACCCGGTGGCCCTGGTGGCAAATTTGGTGCCAAGGGTCCT
AGAGGTCCCAAGACTATTATTGTTAAGCATAGATTAGAAGGTGTTTTCATCTGCAAAGGT
CAATAAGAAGCTTTGGTAACTAAAAATTTCTTCCCTGGTGAATCTGTTTACAATGAAAAA
CGTATGTCCGTTGAAGAAAACGGTGAAAAGATTGAATATCGTGTCTGGAATCCCTACAGA
TCTAAAATTGCTGCTGCTGTTGTTGGTGGTATTTCTGATATTCATATTAAACCTGGCTCC
AAGGTTCTCTATTTGGGTGGTGCCTCTGGTACAACTGTCTCTCACGTTGCTGATATTGTT
GGACCCACTGGTGTTGTCTATGCTGTCGAATTCTCTCACAGAAGTGGTAGAGATTTGGTA
AATATGGCTAAGAAGAGAACCAATGTTGTTCCCATTATCGGTGATGCTAGAAAGCCCCAA
GAATACAGATTCTTAGTCGGTATGGTCGATGTCGTCTTCGCTGATGTTGCCCAACCTGAT
CAAGCTAGAATTATGGGTATGAACTGTTAATACTTCTTAAAGAATGGTGGTCACTTCCTT
ATCTCCATTAAGGCTTGCTGTATTGATTCAACCAACGAACCTGCAGTCGTTTTCGCTGCT
GAAGTACAAAAATTAAAAGAAGAAGGTCTCAAGCCTGAATAATAACTTACTCTTGAACCT
TATGAAAGAGATCACGCTATGGTCCTCGGTTCTTACAGAGCTTGA


>TTHERM_00138080(gene)
ATGGGTAAAGATTTCAAGTCAGGTGGTGGCAATGCTGGTGGAAAGCCCTTCAATAAAGGT
CCTGGAGGTCCTGGTGGAAGACCCTTCAATAAGGGTCCTGGTGGTCCCGGTGGTCCTGGT
GGCAAATTCGGTGGTGGCAGACCCGGTGGCCCTGGTGGCAAATTTGGTGCCAAGGGTCCT
AGAGGTCCCAAGACTATTATTGTTAAGCATAGATTAGAAGGTGTTTTCATCTGCAAAGGT
CAATAAGAAGCTTTGGTAACTAAAAATTTCTTCCCTGGTGAATCTGTTTACAATGAAAAA
CGTATGTCCGTTGAAGAAAACGGTGAAAAGATTGAATATCGTGTCTGGAATCCCTACAGA
TCTAAAATTGCTGCTGCTGTTGTTGGTGGTATTTCTGATATTCATATTAAACCTGGCTCC
AAGGTTCTCTATTTGGGTATATATTTTAATTCTTTTCAATTAATTGATACAGCTTTGAAT
AGTTTGCATACAGCAAGGCTGTTTAAAAACAAAAATGCTAGATACTAATCAGATGGTTGA
CTTTAAAATATAATCAACTCAATCAATTATTGCAAAATATTAAAAAAGATTGATAGATAG
AAAGTATGTATGTATGTATGGGATACTCTACTTAAAATAAAATAAGTATTTGTTATACAA
ATATAAAGTAGGATTAATTCAATGCAGATAGATAGTTAGCATTTGCAAAAATATAAAATC
CCATAATGAAAATTGTAGCTGATTGTATTGAATAAATAAATACATTTCTATCTACAATAA
AAAGCATTTGAAAGATATATTTATCTTACAACATATACTACTAATATATAAATCGATAAA
TGAATGAATAAATAAATAGAATTTTTAAATTTTGCTTTAATCAATAATCCATATAAAATT
TACGCTGCTATTCTAAATAAATAAGTCAATAGCAATTAATTTTACTAAAATAAAATTTAT
TTTAGGATATTTTTATAACAAACAAACAAAGAAAGAATGATGGTTAAATTCATAGAGATT
TATATCTGAATTTATTTAACATCGATTATATCATTTAATTTCAATCAATTGAGTTAAAAA
TCTCTCATGAATAATGATATATTTTATAAACTTACTTATTTCTTTATTTTTAAGATGTAG
AAATAATTAATTCCCATCGATAATATAATAGAATCATCTAGCAAAATTTTTATTTAAACA
CATATTAAATTAAATTAATTATAAATAGGTGGTGCCTCTGGTACAACTGTCTCTCACGTT
GCTGATATTGTTGGACCCACTGGTGTTGTCTATGCTGTCGAATTCTCTCACAGAAGTGGT
AGAGATTTGGTAAATATGGCTAAGAAGAGAACCAATGTTGTTCCCATTATCGGTGATGCT
AGAAAGCCCCAAGAATACAGATTCTTAGTCGGTATGGTCGATGTCGTCTTCGCTGATGTT
GCCCAACCTGATCAAGCTAGAATTATGGGTATGAACTGTTAATACTTCTTAAAGAATGGT
GGTCACTTCCTTATCTCCATTAAGGCTTGCTGTATTGATTCAACCAACGAACCTGCAGTC
GTTTTCGCTGCTGAAGTACAAAAATTAAAAGAAGAAGGTCTCAAGCCTGAATAATAACTT
ACTCTTGAACCTTATGAAAGAGATCACGCTATGGTCCTCGGTTCTTACAGAGCTTGA