Identifiers and Description

Gene Model Identifier

TTHERM_00780850

Standard Name

FEN1 (FENestrin)

Aliases

PreTt01297 | 130.m00107 | 3738.m00043

Description

fenestrin; putative two-component sensor protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

  • ( PF04212 ) MIT domain
  • ( PF00261 ) Tropomyosin
  • ( PF01576 ) Myosin tail
  • ( PF00435 ) Spectrin repeat
  • ( PF01920 ) Prefoldin subunit
  • ( PF00170 ) bZIP transcription factor
  • ( PF07926 ) TPR/MLP1/MLP2-like protein
  • ( PF00038 ) Intermediate filament protein
  • ( PF03131 ) bZIP Maf transcription factor
  • ( TIGR02559 ) type III secretion protein HrpB7
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( PF06698 ) Protein of unknown function (DUF1192)
  • ( PF08385 ) Dynein heavy chain, N-terminal region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.5%

TetraMine Data

TTHERM_00780850

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18681.19.997093137033517e-262hypothetical protein (630 aa)
OxytrichaContig11784.0.g110.0002999184360822198Reovirus sigma C capsid protei
n

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18681839: Cole ES, Anderson PC, Fulton RB, Majerus ME, Rooney MG, Savage JM, Chalker D, Honts J, Welch ME, Wentland AL, Zweifel E, Beussman DJ (2008) A proteomics approach to cloning fenestrin from the nuclear exchange junction of tetrahymena. The Journal of eukaryotic microbiology 55(4):245-56
  2. Ref:13677452: Kaczanowska J, Joachimiak E, Kiersnowska M, Krzywicka A, Golinska K, Kaczanowski A (2003) The fenestrin antigen in submembrane skeleton of the ciliate Tetrahymena thermophila is proposed as a marker of cell polarity during cell division and in oral replacement. Protist 154(2):251-64
  3. Ref:7804251: Nelsen EM, Williams NE, Yi H, Knaak J, Frankel J (1995) "Fenestrin" and conjugation in Tetrahymena thermophila. The Journal of eukaryotic microbiology 41(5):483-95

Sequences

>TTHERM_00780850(coding)
ATGAACTAATCTAACCCAAATCGTGGATAGACTTCAAGTAGCATGTTTATAACTAGCTCT
TAAGTCGTTACCAGTAGCAAGGTTGACACAAATAAGGTCTACAATCCTAACTCTAGAAAG
GATTGGAAGTCTGGTACCTAATAGCTTGCTGAAATTTTCTAAGGCAAAGACGAAGAAATA
GAATACTGGAAGAGTTAGGTCCAACAACAAGAAATAACAATTTCCTAATTGGAAATTGTA
AGAGAATAGAAGACCAACTGTGAACATGAAATCTTACAATTGAAGCAAATTCTCAATCAA
AGAGATTATGAAAATGAAGCTCTCAAGAGAAGTTTGGATGACACTAATCGTGCTAAGGAT
GCAAAAATTAATGAACTTGAAGAAAAGTGCACAAACTTAGCTGTTGAAAACGAAAGACTT
AGAAATATCATCAATGCTAAAAATGGAGATATTGAAAAGAGTAAAACTATTATAACATAG
TTAGAGATTAAGGTTGGTGACATGAAGAGACTTGAAGCCGCCATCCAAGAAAAAGACGGT
CAAATCCACTTACTCTTGTAGAACATTGAAGAATGGAAACAAAGAAATGTTTAATAAGAG
AGATACATTGAAGAATTAAAGAGATATTAAGACCTTTGCAAGGATTACGAATTCAAGATG
GGTTAACTCACTAATGAAATCGAAAGACTCAACAATGTCATCAAGAACTACATTCAAGAA
AATGAGAGTCAAAGATCTAGAATCGCTGACCTCGAACTTCAATGTGGTTAAATGCGTTCT
TTGGAAGCTCGTATCAAGGAATACGAAAACAGAATTGTTATGCTTACATCTGAAATTAAC
CGCTTAAATGAAGTTATTGGACAAAGAACTATGGAAGTTCAAGACTGGAAGGATAAATGC
AAACAATTAGAAGTTACCATTATTAACTTAAAGGTATTCGAAGAAAAGTGCAGAGATTAT
GAATAATAAATCAGAAATCTCAGCCAAATGCTCTCCGATGAAAAGGCTAAGTATAGCAAT
TTGGAAAGACTCTACGAACAAGCCAAGCTTTTGGAAGTGAAGATTAGAGAATACGAAAAT
AAGGTTGTTTTACTTACTTAAGAAATCGAACGTCTTAACAATGTCATCGGATAAAAGCTT
TAGGAATTAGACTAAGCTCGTAACCAAATCTTATAGCTTGAATAATAACTTGTTAAGTAT
AAGGGTATTGAATAAAAGGTCATTGAATATGAAAATAGAATCATGAGTTTCTCATAAGAA
ATCGAAAGATTAAGAAGTCTCTTGGACTAACGTTAAGCTGAAATAGATGAATGGAGAAAT
AAATGCGCCATTCTTGAAGATAACTGCAGAAATTATGAAAATCAAATCCGTATGTTAAAC
TAAAGAATAATGGAGCTCACCCAATAAATCGATAATTTAACAAGACAATTACAAGATGCT
TTAGCTGAAAATGATGACCACAGAGTAAAGAGAAGCAAATAACAAAAGGATTTAATTGAC
TGGGAAGCTAAGGTAGCCTTGTTAACCACTGAAATCGAACGTCTTAGAACTTTACTTATC
AGAAAGGATGAAGAAATCGAACAATGGAAACAAAAGTACTTCAAACTCGAAGCTACTCTT
TCTGAACTACACATCTTAAGAGAAAAGAACAGAGTCTTGAATAGTGAAATTGACAGATTA
AATGCTTTGATTTCTGAATTAGAAACTGAAAATGCTCAATTAAAACTTTCATTGGTCAAT
ATTAATGACTTATAACTTAAAATATAAGATTTGCTTATGCTCTCAGTATAACTCTTCGCT
GAAATCGAATCATTAAGATCCAGAGTTAAGGATAAAGAAAAATAAGTTGACGAAATGAGA
CGTTCTTCTCTTGCTGCTTACAGAAACTGA


>TTHERM_00780850(protein)
MNQSNPNRGQTSSSMFITSSQVVTSSKVDTNKVYNPNSRKDWKSGTQQLAEIFQGKDEEI
EYWKSQVQQQEITISQLEIVREQKTNCEHEILQLKQILNQRDYENEALKRSLDDTNRAKD
AKINELEEKCTNLAVENERLRNIINAKNGDIEKSKTIITQLEIKVGDMKRLEAAIQEKDG
QIHLLLQNIEEWKQRNVQQERYIEELKRYQDLCKDYEFKMGQLTNEIERLNNVIKNYIQE
NESQRSRIADLELQCGQMRSLEARIKEYENRIVMLTSEINRLNEVIGQRTMEVQDWKDKC
KQLEVTIINLKVFEEKCRDYEQQIRNLSQMLSDEKAKYSNLERLYEQAKLLEVKIREYEN
KVVLLTQEIERLNNVIGQKLQELDQARNQILQLEQQLVKYKGIEQKVIEYENRIMSFSQE
IERLRSLLDQRQAEIDEWRNKCAILEDNCRNYENQIRMLNQRIMELTQQIDNLTRQLQDA
LAENDDHRVKRSKQQKDLIDWEAKVALLTTEIERLRTLLIRKDEEIEQWKQKYFKLEATL
SELHILREKNRVLNSEIDRLNALISELETENAQLKLSLVNINDLQLKIQDLLMLSVQLFA
EIESLRSRVKDKEKQVDEMRRSSLAAYRN


>TTHERM_00780850(gene)
AACAACTATTTAAATAAAAAGAATTTATTTATAAAATTAAATATTCAAAAAAAATAAAAA
AAATCAGATCAATCTCTGTAAGAAAGTAAAAAAAGAATTTAAAACTATCTTAAAATGAAC
TAATCTAACCCAAATCGTGGATAGACTTCAAGTAGCATGTTTATAACTAGCTCTTAAGTC
GTTACCAGTAGCAAGGTTGACACAAATAAGGTCTACAATCCTAACTCTAGAAAGGATTGG
AAGTCTGGTACCTAATAGCTTGCTGAAATTTTCTAAGGCAAAGACGAAGAAATAGAATAC
TGGAAGAGTTAGGTCCAACAACAAGAAATAACAATTTCCTAATTGGAAATTGTAAGAGAA
TAGAAGACCAACTGTGAACATGAAATCTTACAATTGAAGCAAATTCTCAATCAAAGAGAT
TATGAAAATGAAGCTCTCAAGAGAAGGTAAAAAAATAATCCTTTACTTATATTTTTAAAA
AGTTTTTTAAAAATGACTTTCTGTTTTAATTCCTTAATGTCTGTACATTCTTTTTACTAA
GGAAATACCTTATGCTAAGGCTATACTAGTCCATTGATAGCCTTAGTTTATTATTATTTG
ATAATTTTATCTTTGTTCGATATGAGTTATGTATTTTAGGACTGAGGATGTTCCATCAAA
ACATAATTTATCAAATTTTAAAATCGATGTTTAAATTTTATTTTTAATAAATAAAGTTTG
GATGACACTAATCGTGCTAAGGATGCAAAAATTAATGAACTTGAAGAAAAGTGCACAAAC
TTAGCTGTTGAAAACGAAAGACTTAGAAATATCATCAATGCTAAAAATGGAGATATTGAA
AAGAGTAAAACTATTATAACATAGTTAGAGATTAAGGTTGGTGACATGAAGAGACTTGAA
GCCGCCATCCAAGAAAAAGACGGTCAAATCCACTTACTCTTGTAGAACATTGAAGAATGG
AAACAAAGAAATGTTTAATAAGAGAGATACATTGAAGAATTAAAGAGATATTAAGACCTT
TGCAAGGATTACGAATTCAAGATGGGTTAACTCACTAATGAAATCGAAAGACTCAACAAT
GTCATCAAGAACTACATTCAAGAAAATGAGAGTCAAAGATCTAGAATCGCTGACCTCGAA
CTTCAATGTGGTTAAATGCGTTCTTTGGAAGCTCGTATCAAGGAATACGAAAACAGAATT
GTTATGCTTACATCTGAAATTAACCGCTTAAATGAAGTTATTGGACAAAGAACTATGGAA
GTTCAAGGTAAATTTTACTTTCTAGCTTATTTAGCTAAAAAAAGCATTTGATCAATCAAA
ATAGGCTCCAATATTGATAGATATTAAGTGTTGAATTCAATAGAAAAAAAAATTCCAAAT
TTAATTTTGCAAAATAAATTTTGAGATAAATAGATTAATTTCTTTTTAAATAATATTCAA
ACATATCTAGATAAATTAATTAATTAATTAATTAATAAAAACCAGTTTTTAATTCAAAAC
GATATAGCGAATCAATTATTTTAATGGGAAATATTTGTTTGCAAAAATCAAACACATAAA
CATAATTTCAATTAAAAAAATTCCAATTTATTAATATTTGCCTATCTTTATCAATCAAAT
ATAACATTTTTAAATTCACAAAGATGATTTTTTGCTATGACTTAAAAGAAATAAATTGTA
AATAATAACTTTGTATTATTAATAGACTGGAAGGATAAATGCAAACAATTAGAAGTTACC
ATTATTAACTTAAAGGTATTCGAAGAAAAGTGCAGAGATTATGAATAATAAATCAGAAAT
CTCAGCCAAATGCTCTCCGATGAAAAGGCTAAGTATAGCAATTTGGAAAGACTCTACGAA
CAAGCCAAGCTTTTGGAAGTGAAGATTAGAGAATACGAAAATAAGGTTGTTTTACTTACT
TAAGAAATCGAACGTCTTAACAATGTCATCGGATAAAAGCTTTAGGAATTAGACTAAGCT
CGTAACCAAATCTTATAGCTTGAATAATAACTTGTTAAGTATAAGGGTATTGAATAAAAG
GTCATTGAATATGAAAATAGAATCAGTAAATAAATAAATAATTTATTTGTATCTAATATA
ATTTATATTCTAAATAAAATAGTGAGTTTCTCATAAGAAATCGAAAGATTAAGAAGTCTC
TTGGACTAACGTTAAGCTGAAATAGATGAATGGAGAAATAAATGCGCCATTCTTGAAGAT
AACTGCAGAAATTATGAAAATCAAATCCGTATGTTAAACTAAAGAATAATGGAGCTCACC
CAATAAATCGATAATTTAACAAGACAATTACAAGATGCTTTAGCTGAAAATGATGACCAC
AGAGTAAAGAGAAGCAAATAACAAAAGGATTTAATTGACTGGGAAGCTAAGGTAGCCTTG
TTAACCACTGAAATCGAACGTCTTAGAACTTTACTTATCAGAAAGGATGAAGAAATCGAA
CAATGGAAACAAAAGTACTTCAAACTCGAAGCTACTCTTTCTGAACTACACATCTTAAGA
GAAAAGAACAGAGTCTTGAATAGTGAAATTGACAGATTAAATGCTTTGATTTCTGAATTA
GAAACTGAAAATGCTCAATTAAAACTTTCATTGGTCAATATTAATGACTTATAACTTAAA
ATATAAGATTTGCTTATGCTCTCAGTATAACTCTTCGCTGAAATCGAATCATTAAGATCC
AGAGTTAAGGATAAAGAAAAATAAGTTGACGAAATGAGACGTTCTTCTCTTGCTGCTTAC
AGAAACTGA