Identifiers and Description

Gene Model Identifier

TTHERM_00666960

Standard Name

FDD4 (Fatty acid Desaturase Domain)

Aliases

PreTt23948 | 99.m00189

Description

Fatty acid desaturase family protein; fatty acid desaturase-related protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.5%

TetraMine Data

TTHERM_00666960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16588.19.997093137033517e-262fatty acid desaturase (385 aa)
OxytrichaContig9505.0.g592.0005131442217614e-40Fatty acid desaturase
Stentor CoeruleusSteCoe_112660.000000000000012664165549094176

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00666960(coding)
ATGGATATATTTTTAGATTCTTTGCAGTTTTACACCCCTGTTTTTAACAACATACTTCTA
TTTATAGGGGCAGAGTACTTTAATAATGGATATTTTTTAGGCTTTTTTTTGCAGTGCTTA
GCAAAAAAGGTCGATTAGATTTTACCCTTGGATGACAAGAATATGAATAAAGAAGAATCA
AATAGAAAGAAAAACCATTTTTTATACACAATCCCTCTATTTTTAGCTGTTATTTCTGAT
ACATTGTAAATGTTTTATGTGATAAATAAAGTTACTAGCAGTGGCTCTTAACTTTCTGCC
TTGAACTGCTTCCTTTTGATAAGCTCTGCAGGTTTAACTTTGGGTAATACTGTTAATGTT
TCGCATGAGTTAATTCATAGATTAACAACTTTAGAGTAGGCAGTAGGATTTTTGAATTTT
GTAAGAGTTATGTACTGCCATTATCCTATATTCCATTTGCTATGGCACCATAAGCATGTT
GGAACTGACAAAGATCCTATTGTAGCAAAAAAAGATGAAACTTTGTATTAGTATCTTCCT
AGATAGCTTTGGGGTAACTACGCTGTTTCATGGAAGTGTGAAAATGAAAGATTGATTTAA
CAAGAAAAGACTTCATTCCCTTAATTTCATTACAAAAATAGAATGATTTATAATACTCTG
CTTTAACTTGCCTTCCCTTTACTAATGCTGGTTACATATGGAAGAAAAGGATTATATTAC
TATTTATGGATGGTTTTTGTAGCAGTTATTGAAGCTGAAATTGTTGAATACTTGGAACAT
TATGGTCTTTTTGTCACAAAAGATAATAAAGTTTCTTACGATTGTGCTTGGAACTCTCCT
TAAAGGTATACAAACATATCTTCATTTAAGCTTGAAAGACATGCTGATCATCATGTAAAT
GCCTATAAAGAATATTAAATTTCAAGCTTCGATTATTCATGGCCTTAGCTGCCTGAGAGC
TACTTATTTATGATTTAGGTTTCAATGTAACCAAAGCTCTGGTTTTCTATCATGAATCCT
CGTTTAGAGTCCTTTTTTGCTAAAAAAGAAGTGTCTAAGGAGCATTAAGAATTCGAAAAA
AAGACTCTTGATAATTTCTATAAATAGCAAATCTTGACTCACTCAATAATTTTATTAATC
TCATTCTTATTTTGA


>TTHERM_00666960(protein)
MDIFLDSLQFYTPVFNNILLFIGAEYFNNGYFLGFFLQCLAKKVDQILPLDDKNMNKEES
NRKKNHFLYTIPLFLAVISDTLQMFYVINKVTSSGSQLSALNCFLLISSAGLTLGNTVNV
SHELIHRLTTLEQAVGFLNFVRVMYCHYPIFHLLWHHKHVGTDKDPIVAKKDETLYQYLP
RQLWGNYAVSWKCENERLIQQEKTSFPQFHYKNRMIYNTLLQLAFPLLMLVTYGRKGLYY
YLWMVFVAVIEAEIVEYLEHYGLFVTKDNKVSYDCAWNSPQRYTNISSFKLERHADHHVN
AYKEYQISSFDYSWPQLPESYLFMIQVSMQPKLWFSIMNPRLESFFAKKEVSKEHQEFEK
KTLDNFYKQQILTHSIILLISFLF


>TTHERM_00666960(gene)
ATGGATATATTTTTAGATTCTTTGCAGTTTTACACCCCTGTTTTTAACAACATACTTCTA
TTTATAGGGGCAGAGTACTTTAATAATGGATATTTTTTAGGCTTTTTTTTGCAGTGCTTA
GCAAAAAAGGTCGATTAGATTTTACCCTTGGATGACAAGAATATGAATAAAGAAGAATCA
AATAGAAAGAAAAACCATTTTTTATACACAATCCCTCTATTTTTAGCTGTTATTTCTGAT
ACATTGTAAATGTTTTATGTGATAAATAAAGTTACTAGCAGTGGCTCTTAACTTTCTGCC
TTGAACTGCTTCCTTTTGATAAGCTCTGCAGGTTTAACTTTGGGTAATACTGTTAATGTT
TCGCATGAGTTAATTCATAGATTAACAACTTTAGAGTAGGCAGTAGGTAAGTTAATCATT
ATTTTTTATAGATCCAATGCTATTTTTATTATTTTAAATAGGATTTTTGAATTTTGTAAG
AGTTATGTACTGCCATTATCCTATATTCCATTTGCTATGGCACCATAAGCATGTTGGAAC
TGACAAAGATCCTATTGTAGCAAAAAAAGATGAAACTTTGTATTAGTATCTTCCTAGATA
GCTTTGGGGTAACTACGCTGTTTCATGGAAGTGTGAAAATGAAAGATTGATTTAACAAGA
AAAGACTTCATTCCCTTAATTTCATTACAAAAATAGAATGATTTATAATACTCTGCTTTA
ACTTGCCTTCCCTTTACTAATGCTGGTTACATATGGAAGAAAAGGATTATATTACTATTT
ATGGATGGTTTTTGTAGCAGTTATTGAAGCTGAAATTGTTGAATACTTGGAACATTATGG
TCTTTTTGTCACAAAAGATAATAAAGTTTCTTACGATTGTGCTTGGAACTCTCCTTAAAG
GTATACAAACATATCTTCATTTAAGCTTGAAAGACATGCTGATCATCATGTAAATGCCTA
TAAAGAATATTAAATTTCAAGCTTCGATTATTCATGGCCTTAGCTGCCTGAGAGCTACTT
ATTTATGATTTAGGTTTCAATGTAACCAAAGCTCTGGTTTTCTATCATGAATCCTCGTTT
AGAGTCCTTTTTTGCTAAAAAAGAAGTGTCTAAGGAGCATTAAGAATTCGAAAAAAAGAC
TCTTGATAATTTCTATAAATAGCAAATCTTGACTCACTCAATAATTTTATTAATCTCATT
CTTATTTTGA