Identifiers and Description

Gene Model Identifier

TTHERM_00666950

Standard Name

FDD3 (Fatty acid Desaturase Domain)

Aliases

PreTt23947 | 99.m00188

Description

Fatty acid desaturase family protein; fatty acid desaturase-related protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00487 ) Fatty acid desaturase
  • ( PF07145 ) Ataxin-2 C-terminal region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.9%

TetraMine Data

TTHERM_00666950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16587.19.997093137033517e-262fatty acid desaturase (395 aa)
OxytrichaContig9505.0.g598.998068369452149e-53Fatty acid desaturase
Stentor CoeruleusSteCoe_112660.000000000000004658886145103398

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00666950(coding)
ATGTAAGAAAAAAAGTTTAAACAATTTGAGTAGAATTTGAATACAGCTTTTGATTCACTA
AAATTCTACACACCAGTTATGATTGCACTTATTGTTGTGTTTGGCATGGAATATTTAAAG
ACTGGATATGCTTTAGTCTTTTTCCATCACTGTATTGCTCCAATCCTTGATAGATTTATG
CCTTATGATGACATTAATTATAACAAAGAAGATGAAAAATAAAAGAAATATAGCATTTTC
TACTCAATCCCATTATATGTCGCTATCATTGTTGATGTTTTGCTGATGATTTATACATTA
TATAAAATTTGTTTCACACCTCTTTCTATTTTCTAAGCTATTTTCCTTGCTTTCTCTGCA
TCTCTTTCATTGGGAAGCACTATTAACGTTTCTCATGAGCTGATCCATCGACTTTCTCCT
TTTGAATAATCAGCAGGTATTTTTAACCTGATGAGAATGATGTATGCTCACTATTAAATT
GCCCATATAATGTCTCATCATAAGTATGTCGGAACAAAGAAAGATCCTGTTGTTGCTTAG
AGGAACGAATCAATTTTTGCTTATATGTTAAGATAAATTTAACAAACTTATATCAAAGCT
TGGAACTGTGAAAATGAAAGAGTTGTAAAGTTCCATAAGGCATCTAATCCCTTTTTAAGT
ATATATAATAGAATGATTTACTATTCTATTGCATAACTACTAGTTCCAACCGTAGTTTAT
AAAATATGTGGTCTTTATGGTCTAGGATTCTATTTATTAATGGTAATAATTAGTGTTGCA
GAATCATTAGTAATAGAATATATAGAGCATTATGGATTAACTTAATATTAGGATATTGAC
ATACAATATGACTCTTCATGGAATGCTCCTCATAAGTTTAGTAATATGCTCTCTTTTCGC
TTTGAAAGACACTCTGATCATCATGTAAATGCTCATAAAGAATACTAAGTGACTCAATTC
AATTATGAGTGGCCAACACTTCCAGAAAGTTATGCAAGTTGTATGCATATCGCGTTATAA
CCTTCTGAATGGATGAAAGTTATGAACACAAGATTAGATGCGGTTATTAATAAAAAATAG
TTAAGTTAACAACAATTAGTTGAAGAAAGAGATATTATCAACAAAGTGCTTATCAAAACA
TTTTCTATTCACGCTGCATTATTTGTTGTTTCATTCTTTATTAAATGA


>TTHERM_00666950(protein)
MQEKKFKQFEQNLNTAFDSLKFYTPVMIALIVVFGMEYLKTGYALVFFHHCIAPILDRFM
PYDDINYNKEDEKQKKYSIFYSIPLYVAIIVDVLLMIYTLYKICFTPLSIFQAIFLAFSA
SLSLGSTINVSHELIHRLSPFEQSAGIFNLMRMMYAHYQIAHIMSHHKYVGTKKDPVVAQ
RNESIFAYMLRQIQQTYIKAWNCENERVVKFHKASNPFLSIYNRMIYYSIAQLLVPTVVY
KICGLYGLGFYLLMVIISVAESLVIEYIEHYGLTQYQDIDIQYDSSWNAPHKFSNMLSFR
FERHSDHHVNAHKEYQVTQFNYEWPTLPESYASCMHIALQPSEWMKVMNTRLDAVINKKQ
LSQQQLVEERDIINKVLIKTFSIHAALFVVSFFIK


>TTHERM_00666950(gene)
ATGTAAGAAAAAAAGTTTAAACAATTTGAGTAGAATTTGAATACAGCTTTTGATTCACTA
AAATTCTACACACCAGTTATGATTGCACTTATTGTTGTGTTTGGCATGGAATATTTAAAG
ACTGGATATGCTTTAGTCTTTTTCCATCACTGTATTGCTCCAATCCTTGATAGATTTATG
CCTTATGATGACATTAATTATAACAAAGAAGATGAAAAATAAAAGAAATATAGCATTTTC
TACTCAATCCCATTATATGTCGCTATCATTGTTGATGTTTTGCTGATGATTTATACATTA
TATAAAATTTGTTTCACACCTCTTTCTATTTTCTAAGCTATTTTCCTTGCTTTCTCTGCA
TCTCTTTCATTGGGAAGCACTATTAACGTTTCTCATGAGCTGATCCATCGACTTTCTCCT
TTTGAATAATCAGCAGGTATATTATTAATTATTTTATATTATCATTGCATATTGCATGAA
TAATCCTAATCGATTAAATATGTAAATGGCAGATAAATCTCAACATTTAAAATATTTAAT
AACAAGCATTTATTTATTTTTTACAATAGATATTAATTATTATAAAACAAAAAAAGGTAT
TTTTAACCTGATGAGAATGATGTATGCTCACTATTAAATTGCCCATATAATGTCTCATCA
TAAGTATGTCGGAACAAAGAAAGATCCTGTTGTTGCTTAGAGGAACGAATCAATTTTTGC
TTATATGTTAAGATAAATTTAACAAACTTATATCAAAGCTTGGAACTGTGAAAATGAAAG
AGTTGTAAAGTTCCATAAGGCATCTAATCCCTTTTTAAGTATATATAATAGAATGATTTA
CTATTCTATTGCATAACTACTAGTTCCAACCGTAGTTTATAAAATATGTGGTCTTTATGG
TCTAGGATTCTATTTATTAATGGTAATAATTAGTGTTGCAGAATCATTAGTAATAGAATA
TATAGAGCATTATGGATTAACTTAATATTAGGATATTGACATACAATATGACTCTTCATG
GAATGCTCCTCATAAGTTTAGTAATATGCTCTCTTTTCGCTTTGAAAGACACTCTGATCA
TCATGTAAATGCTCATAAAGAATACTAAGTGACTCAATTCAATTATGAGTGGCCAACACT
TCCAGAAAGTTATGCAAGTTGTATGCATATCGCGTTATAACCTTCTGAATGGATGAAAGT
TATGAACACAAGATTAGATGCGGTTATTAATAAAAAATAGTTAAGTTAACAACAATTAGT
TGAAGAAAGAGATATTATCAACAAAGTGCTTATCAAAACATTTTCTATTCACGCTGCATT
ATTTGTTGTTTCATTCTTTATTAAATGA