Identifiers and Description

Gene Model Identifier

TTHERM_00444260

Standard Name

FDD2 (Fatty acid Desaturase Domain)

Aliases

PreTt03794 | 51.m00160 | 3704.m00015

Description

Fatty acid desaturase family protein; fatty acid desaturase-related protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00444260

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10933.19.997093137033517e-262fatty acid desaturase (406 aa)
OxytrichaContig9505.0.g597.00270765106311e-74Fatty acid desaturase
Stentor CoeruleusSteCoe_112661.9792598779469045e-32

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00444260(coding)
ATGGCTATCACTGTTGTCAATCCTAACGGTCATCGCTCTCTTTAACCTTTTTATAAGGGA
GAAGAAATGATTTTGTTTAGTTCTATACAATACTATTTAGTTCCTTTTATTTACTGTTTA
GGTTATCTAGGAGTTATGTACTTACACAATCCTTACCTATTGATTTTTATTGCTTATTCT
CTAATCCCTTTTTTGGACTCATTTTTTAACTTTGATCTTAGAAATCCTACAAAAGAAGAG
TAGAAGTAACTTGAAGGTAAGCTTCGCTTTAAAATCCCACTCTATTTTGCTGTACTTACT
GAGTGGATTTTCTCAACTTGGATCATTTACTATGTCACATAAAATAGCTAAAATATCAGC
TTATTTAACTTAATTGGTATTATATTTCTTACAGGTAATGGCTCTGCTTCAAATATCAAT
GTAGCTCATGAGCTCTTCCATAAAACAGGTTTGCTAGACAAATTCTTTGGTACATTCACA
CTTGCAAAGAATCTATACATGCATTTCACAATAGAACACTAATATGGTCATCATAGAAAC
GTTTCTACCCCCAATGACCCTGCTACTTCAAGATATGGGTAGACATTATATGAATACCTC
CCTTAAACCATCATTGGTTCTTATTTTAGTGCTTGGAGAATAGAAAATAAATTCTAACGT
TTATAAGGAAGACACCCTTTTAATCCATTCAATAAAATGATTATTTATACCATTCTCTAC
TTCATTATTCCATACATTCATTATCTAGTATTTGGTTTATATGGAATGTTCTTTTTCTTG
TGCACAGCTTTTATTTCAGTAATTTATTTAGAGGCTATTAACTACATTGAGCACTATGGT
TTAATGAGAGAAAAAACTGAAGATGGACATTACGAAAAAGTTGATATTAGACATTCATGG
AACGCACCTCATAGATTTTCTAACTATCTCTTATTTAAGCTCTAAAGACACTCAGATCAC
CATGAAAACGGATATAAGGAATACTAAACTCTCTGTAGTTATACTGATAGTCCGACCCTT
CCTCATGGATATCCAGTTTGCATTTTAATTAGTTTCTATCCTCCACTATGGTTCGAAATA
ATGCACGAAGTACTCGAATCTTATAAAAAAGAAAAGAAATCAATACCATTACCCAACATA
GAAAAAAAGATAGATAATTACACTTAAAAAGTGTCTTTAATTACAATGACCCTTTCAGTT
TTATCATTTTTTATTTGA


>TTHERM_00444260(protein)
MAITVVNPNGHRSLQPFYKGEEMILFSSIQYYLVPFIYCLGYLGVMYLHNPYLLIFIAYS
LIPFLDSFFNFDLRNPTKEEQKQLEGKLRFKIPLYFAVLTEWIFSTWIIYYVTQNSQNIS
LFNLIGIIFLTGNGSASNINVAHELFHKTGLLDKFFGTFTLAKNLYMHFTIEHQYGHHRN
VSTPNDPATSRYGQTLYEYLPQTIIGSYFSAWRIENKFQRLQGRHPFNPFNKMIIYTILY
FIIPYIHYLVFGLYGMFFFLCTAFISVIYLEAINYIEHYGLMREKTEDGHYEKVDIRHSW
NAPHRFSNYLLFKLQRHSDHHENGYKEYQTLCSYTDSPTLPHGYPVCILISFYPPLWFEI
MHEVLESYKKEKKSIPLPNIEKKIDNYTQKVSLITMTLSVLSFFI


>TTHERM_00444260(gene)
ATGGCTATCACTGTTGTCAATCCTAACGGTCATCGCTCTCTTTAACCTTTTTATAAGGGA
GAAGAAATGATTTTGTTTAGTTCTATACAATACTATTTAGTTCCTTTTATTTACTGTTTA
GGTTATCTAGGAGTTATGTACTTACACAATCCTTACCTATTGATTTTTATTGCTTATTCT
CTAATCCCTTTTTTGGACTCATTTTTTAACTTTGATCTTAGAAATCCTACAAAAGAAGAG
TAGAAGTAACTTGAAGGTAAGCTTCGCTTTAAAATCCCACTCTATTTTGCTGTACTTACT
GAGTGGATTTTCTCAACTTGGATCATTTACTATGTCACATAAAATAGCTAAAATATCAGC
TTATTTAACTTAATTGGTATTATATTTCTTACAGGTAATGGCTCTGCTTCAAATATCAAT
GTAGCTCATGAGCTCTTCCATAAAACAGGTTTGCTAGACAAATTCTTTGGTACATTCACA
CTTGCAAAGAATCTATACATGCATTTCACAATAGAACACTAATATGGTCATCATAGAAAC
GTTTCTACCCCCAATGACCCTGCTACTTCAAGATATGGGTAGACATTATATGAATACCTC
CCTTAAACCATCATTGGTTCTTATTTTAGTGCTTGGAGAATAGAAAATAAATTCTAACGT
TTATAAGGAAGACACCCTTTTAATCCATTCAATAAAATGATTATTTATACCATTCTCTAC
TTCATTATTCCATACATTCATTATCTAGTATTTGGTTTATATGGAATGTTCTTTTTCTTG
TGCACAGCTTTTATTTCAGTAATTTATTTAGAGGCTATTAACTACATTGAGCACTATGGT
TTAATGAGAGAAAAAACTGAAGATGGACATTACGAAAAAGTTGATATTAGACATTCATGG
AACGCACCTCATAGATTTTCTAACTATCTCTTATTTAAGCTCTAAAGACACTCAGATCAC
CATGAAAACGGATATAAGGAATACTAAACTCTCTGTAGTTATACTGATAGTCCGACCCTT
CCTCATGGATATCCAGTTTGCATTTTAATTAGTTTCTATCCTCCACTATGGTTCGAAATA
ATGCACGAAGTACTCGAATCTTATAAAAAAGAAAAGAAATCAATACCATTACCCAACATA
GAAAAAAAGATAGATAATTACACTTAAAAAGTGTCTTTAATTACAATGACCCTTTCAGTT
TTATCATTTTTTATTTGA