Identifiers and Description

Gene Model Identifier

TTHERM_00648790

Standard Name

FDD1 (Fatty acid Desaturase Domain)

Aliases

PreTt09193 | 94.m00111 | 3677.m00019

Description

Fatty acid desaturase family protein; fatty acid desaturase-related protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.5%

TetraMine Data

TTHERM_00648790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12964.19.997093137033517e-262fatty acid desaturase (412 aa)
OxytrichaContig9505.0.g592.0009381340492598e-66Fatty acid desaturase
Stentor CoeruleusSteCoe_112662.9374821117108028e-30

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00648790(coding)
ATGACTAATTCAGAGGATATCACATAACCTAAACTTGAAGTTTCCCACTTCTAAAAAGAT
TTAAAAGCTAAATATGAAGGATAAAATGCTTTGTTATTTAGCTCCTTACAGTACTACTTT
GTACCTTTAATGTATATTTTGGCCTTTGTCAGTATACTTTACTTGAGAACAGGCTACTTA
TTCGTCTTTCTCTTTTACTCTTTCATACCTCTACTAGATGAATTTTGTAGCTACGATATT
CGTAATCCTACTAAAGAAGAAGCTAAGCAACTCACCGGAAAGATTCACTTCAAAATTCCT
TTATACTTGGCAGTTGTCTTCGATTGGCTTTTCACATTCTGGTGTGTTTACTTTATTGCT
GCAAACAAAGACGAAATATCTCTTTTTAATTAGTTTGGTATTATTTTTGTTGCTGGAAAT
CTTGCTGCTTCAAACATTAATGTCGCTCACGAATTGTTCCATAAAAATGGATGGTTCGAC
ATTTTCATGGGAACTTTTACTCTTGCAAAAAATCTTTACATGCATTTCGCTATTGAGCAC
ATATATGGTCATCACCGCAATGTCGCTACTCACAAAGACCCTGCCACATCTCGCTTAAAT
TAGACTCTTTACAAGTTTATTCCTTAAACAATTATTGGCTCCTATTTCAGTGCTTGGCAT
TATGAAAACAACTACCAACGTCTCAAAAATCGCTCTCCAATTAACATTTTTAATAAAATG
ATTTACTACACCTTGAGCATGTTTTTAATTCCTTTCATTGTACAAAAAATATTTGGAACA
TATGGAATGTATGTCTTCTTATTTACTGTTTTTAATTCAGTTTTCTACCTTGAAACAGTA
AATTATATTGAACACTATGGACTTCAAAGAAAAGAAATAGAACCAGGCATCTTTGAAAAA
GTAGACATCCACCACTCATGGAATGCTCCCCACAGATTCTCCAATTATTTGCTTTTTAAA
TTGCAAAGACACTCAGATCATCATGAAAATGGTTACAAAGAATATTAAACTCTTTGCAGT
TATGACGAAAGTCCTACTTTACCCCATGGATACACCGTATGCGTTTTACTAAGCTTTTAT
CCTCCTTCATGGTTTAATATTATGAATAAAGTGTTGGCTAGATACCAAAACGATAAAAAG
ACAATTACATACAAAGACATTCAAAACGAAGTATACAACTATATCCTTAAATTCACAGTT
GTATCTTTAACCCTATTCGTTACAAGTTTATATTTTTGA


>TTHERM_00648790(protein)
MTNSEDITQPKLEVSHFQKDLKAKYEGQNALLFSSLQYYFVPLMYILAFVSILYLRTGYL
FVFLFYSFIPLLDEFCSYDIRNPTKEEAKQLTGKIHFKIPLYLAVVFDWLFTFWCVYFIA
ANKDEISLFNQFGIIFVAGNLAASNINVAHELFHKNGWFDIFMGTFTLAKNLYMHFAIEH
IYGHHRNVATHKDPATSRLNQTLYKFIPQTIIGSYFSAWHYENNYQRLKNRSPINIFNKM
IYYTLSMFLIPFIVQKIFGTYGMYVFLFTVFNSVFYLETVNYIEHYGLQRKEIEPGIFEK
VDIHHSWNAPHRFSNYLLFKLQRHSDHHENGYKEYQTLCSYDESPTLPHGYTVCVLLSFY
PPSWFNIMNKVLARYQNDKKTITYKDIQNEVYNYILKFTVVSLTLFVTSLYF


>TTHERM_00648790(gene)
ATGACTAATTCAGAGGATATCACATAACCTAAACTTGAAGTTTCCCACTTCTAAAAAGAT
TTAAAAGCTAAATATGAAGGATAAAATGCTTTGTTATTTAGCTCCTTACAGTACTACTTT
GTACCTTTAATGTATATTTTGGCCTTTGTCAGTATACTTTACTTGAGAACAGGCTACTTA
TTCGTCTTTCTCTTTTACTCTTTCATACCTCTACTAGATGAATTTTGTAGCTACGATATT
CGTAATCCTACTAAAGAAGAAGCTAAGCAACTCACCGGAAAGATTCACTTCAAAATTCCT
TTATACTTGGCAGTTGTCTTCGATTGGCTTTTCACATTCTGGTGTGTTTACTTTATTGCT
GCAAACAAAGACGAAATATCTCTTTTTAATTAGTTTGGTATTATTTTTGTTGCTGGAAAT
CTTGCTGCTTCAAACATTAATGTCGCTCACGAATTGTTCCATAAAAATGGATGGTTCGAC
ATTTTCATGGGAACTTTTACTCTTGCAAAAAATCTTTACATGCATTTCGCTATTGAGCAC
ATATATGGTCATCACCGCAATGTCGCTACTCACAAAGACCCTGCCACATCTCGCTTAAAT
TAGACTCTTTACAAGTTTATTCCTTAAACAATTATTGGCTCCTATTTCAGTGCTTGGCAT
TATGAAAACAACTACCAACGTCTCAAAAATCGCTCTCCAATTAACATTTTTAATAAAATG
ATTTACTACACCTTGAGCATGTTTTTAATTCCTTTCATTGTACAAAAAATATTTGGAACA
TATGGAATGTATGTCTTCTTATTTACTGTTTTTAATTCAGTTTTCTACCTTGAAACAGTA
AATTATATTGAACACTATGGACTTCAAAGAAAAGAAATAGAACCAGGCATCTTTGAAAAA
GTAGACATCCACCACTCATGGAATGCTCCCCACAGATTCTCCAATTATTTGCTTTTTAAA
TTGCAAAGACACTCAGATCATCATGAAAATGGTTACAAAGAATATTAAACTCTTTGCAGT
TATGACGAAAGTCCTACTTTACCCCATGGATACACCGTATGCGTTTTACTAAGCTTTTAT
CCTCCTTCATGGTTTAATATTATGAATAAAGTGTTGGCTAGATACCAAAACGATAAAAAG
ACAATTACATACAAAGACATTCAAAACGAAGTATACAACTATATCCTTAAATTCACAGTT
GTATCTTTAACCCTATTCGTTACAAGTTTATATTTTTGA