Identifiers and Description

Gene Model Identifier

TTHERM_00058590

Standard Name

FBP1 (Fructose-1,6-BisPhosphatase)

Aliases

PreTt13044 | 4.m00443 | 3707.m00088

Description

fructose-1,6-bisphosphatase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00316 ) fructose-1,6-bisphosphatase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00058590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01961.19.997093137033517e-262fructose-1,6-bisphosphatase (3
40 aa)
WormBaseWBGene000014045.000568126412132e-124locus:fbp-1 status:Confirmed
UniProt:G5EBJ7 protein_id
:CCD68127.1
SGDYLR377C1.9999366565375063e-113FBP1 Fructose-1,6-bisphosphata
se, key regulatory enzyme in t
he gluconeogenesis pathway, re
quired for glucose metabolism;
undergoes either proteasome-m
ediated or autophagy-mediated
degradation depending on growt
h conditions; interacts with V
id30p
DictyBaseDDB_G02708364.0002634815779907e-110fbp on chromosome: 1 position
3681011 to 3682051
Stentor CoeruleusSteCoe_280006.375869581278994e-59
OxytrichaContig8398.0.g931.0002335610448659e-38Fructose-1-6-bisphosphatase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00058590(coding)
ATGTAGATGTATAATCAATAAATTAACACTAAAATAAGTAAAAAAAAAAATATCAAGTAT
CTCCTTATAAAAATGTCTCACACTGCTATCAACACCAACTTTGTCACCTTAACCAGAAAC
TTAGTTTTTGAATAACAATAAGTCAAGGAAGCTTCTGGTGACTTCACTCTCTTACTTTCT
TCCATCCAAACTGCTTGCAAGTTCATCTCTTCCAAGGTCAAGAAGGCTGGTATTGCTAAG
CTCTATGGTCACCACGGTACTGAAAACTCTAGTGGAGATTAAGTCAAGAAGCTCGATATC
CTTTCCAACGAAGTTTTCGTTAACTGTCTTAGATCCAGTGGTAAGGTTGCAATTATGGCT
AGTGAAGAAGAAGACAAGCCCATCGAAGTCGAAATCAAGAACCAAGGTAAATACGTTGTC
AGCTTCGACCCCTTGGACGGTTCCTCTAACATTGATGCTAACGTCTCTATTGGTTCTATC
TTCGCTATCTGGAGAAGATAAACTGAAGAAGAAACTGGTGCAACCATTGAAGATCTCTTA
CAAGATGGCAGAAGCTTAGTTGCTGCTGGTTACTGCTTATATGGTTCTTCTACTCACCTA
GTCCTCTGCACTGGTCACTAAGTTAACGGATACACCTTAGATCCTTCATTGGGTGAATTC
CTCTTGACTCATCCTGACATCAAGATTCCCAAGAGAGGTAACATCTACTCCATCAACGAA
GGTAACTCTACCTACTGGGATGAATCCGTTAAGGAATACATCCAAGCCAAGAAGTTCCCC
ACTGATGGTACTTCTCCCTACTCTCTTAGATACATTGGTTCCATGGTTGCTGATGTTCAC
AGAACTTTACTTTATGGTGGTATCTTCTTATATCCTACCGACAAGAGATCTCCCAAGGGT
AAATTAAGAGTTTTATACGAATGCTTCCCTATGGCTTACATCGTTGAAAAGGCTGGTGGT
AAGGCTATCACTGGAGAATGCAATGTTTTGGATATCAAGCCTAAGTCTATCCATGAAAGA
TGCGGTATCATCTGCGGTTCCGTTGAAGATGTTACTGAAATTGAAAATATTTACAAGACC
CACAAGCAATGA


>TTHERM_00058590(protein)
MQMYNQQINTKISKKKNIKYLLIKMSHTAINTNFVTLTRNLVFEQQQVKEASGDFTLLLS
SIQTACKFISSKVKKAGIAKLYGHHGTENSSGDQVKKLDILSNEVFVNCLRSSGKVAIMA
SEEEDKPIEVEIKNQGKYVVSFDPLDGSSNIDANVSIGSIFAIWRRQTEEETGATIEDLL
QDGRSLVAAGYCLYGSSTHLVLCTGHQVNGYTLDPSLGEFLLTHPDIKIPKRGNIYSINE
GNSTYWDESVKEYIQAKKFPTDGTSPYSLRYIGSMVADVHRTLLYGGIFLYPTDKRSPKG
KLRVLYECFPMAYIVEKAGGKAITGECNVLDIKPKSIHERCGIICGSVEDVTEIENIYKT
HKQ


>TTHERM_00058590(gene)
TACGCAGTTTCTATCTCTTTTAATATAGATTGAATATTTAGCATATGTAGATGTATAATC
AATAAATTAACACTAAAATAAGTAAAAAAAAAAATATCAAGTATCTCCTTATAAAAATGT
CTCACACTGCTATCAACACCAACTTTGTCACCTTAACCAGAAACTTAGTTTTTGAATAAC
AATAAGTCAAGGAAGCTTCTGGTGACTTCACTCTCTTACTTTCTTCCATCCAAACTGCTT
GCAAGTTCATCTCTTCCAAGGTCAAGAAGGCTGGTATTGCTAAGCTCTATGGTCACCACG
GTACTGAAAACTCTAGTGGAGATTAAGTCAAGAAGCTCGATATCCTTTCCAACGAAGTTT
TCGTTAACTGTCTTAGATCCAGTGGTAAGGTTGCAATTATGGCTAGTGAAGAAGAAGACA
AGCCCATCGAAGTCGAAATCAAGAACCAAGGTAAATACGTTGTCAGCTTCGACCCCTTGG
ACGGTTCCTCTAACATTGATGCTAACGTCTCTATTGGTTCTATCTTCGCTATCTGGAGAA
GATAAACTGAAGAAGAAACTGGTGCAACCATTGAAGATCTCTTACAAGATGGCAGAAGCT
TAGTTGCTGCTGGTTACTGCTTATATGGTTCTTCTACTCACCTAGTCCTCTGCACTGGTC
ACTAAGTTAACGGATACACCTTAGATCCTTCATTGGGTGAATTCCTCTTGACTCATCCTG
ACATCAAGATTCCCAAGAGAGGTAACATCTACTCCATCAACGAAGGTAACTCTACCTACT
GGGATGAATCCGTTAAGGAATACATCCAAGCCAAGAAGTTCCCCACTGATGGTACTTCTC
CCTACTCTCTTAGGTAAATAGCTTTTACAAGCTTTCTTATATGAATTTATTATTTTATTC
AGAGCCTTTAATTAAATTCTACTTTTAAAATTTTAGATACATTGGTTCCATGGTTGCTGA
TGTTCACAGAACTTTACTTTATGGTGGTATCTTCTTATATCCTACCGACAAGAGAGTAAT
TATTTTATTTTCACACTTATTAAAATGAAACTATTTATATAGCTAGTTATCAGTTAGCTT
TTTTGGTAGTGTTTAAGCTTAAGCCTACCAAAACAGCTTGCTAGGCATCAATTATAAATT
TATTTTATTAATTAATTCTAAAATGTTTTTTTAATGTAAAATAGTCTCCCAAGGGTAAAT
TAAGAGTTTTATACGAATGCTTCCCTATGGCTTACATCGTTGAAAAGGCTGGTGGTAAGG
CTATCACTGGAGAATGCAATGTTTTGGATATCAAGCCTAAGTCTATCCATGAAAGATGCG
GTATCATCTGCGGTTCCGTTGAAGATGTTACTGAAATTGAAAATATTTACAAGACCCACA
AGCAATGAACAAATTAGCTAAGCATGTGAGTGATGATTGAACTAATAAGTTGGTCCGTCA
TCCTCATTTCAAAAAACAAAAAAAAGCATTGTATAAAAAATAAGGAAAAACATTAGTACT
AAAAACAAGCAAAAATCCTAATAAAAATTAGTTAAAGTTAATTATTAAAGCAAATTTAAA
TCTTATTAGAGAAGAAAGCTTAAATATAGATGAGCAAAGGAACAAAAGGAAAATATATAT
TTAATAAGTAATGAAAATGCAAATGGATCAATACAAATAAAATATTTTAAAACATTCTAT
ATTTATTATAAAATTCAATTTTGATTGTAAATTCATACTTTATATTCTATGTTTTCTTTG
CACAAATATTTATAAAATTTCTTCTGACAATAGGAGATAAAAATA