Identifiers and Description

Gene Model Identifier

TTHERM_00578560

Standard Name

FAP91 (homolog of the Chlamydomonas CSC protein FAP91)

Aliases

PreTt05749 | 78.m00121 | 3733.m00016

Description

calmodulin and spoke-associated complex (CSC) protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00578560

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16287.19.997093137033517e-262hypothetical protein (654 aa)
OxytrichaContig19017.0.g597.996875492733741e-171hypothetical protein
Stentor CoeruleusSteCoe_9761.1983630608508849e-70

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25694453: Urbanska P, Song K, Joachimiak E, Krzemien-Ojak L, Koprowski P, Hennessey T, Jerka-Dziadosz M, Fabczak H, Gaertig J, Nicastro D, Wloga D (2015) The CSC proteins FAP61 and FAP251 build the basal substructures of radial spoke 3 in cilia. Molecular biology of the cell 26(8):1463-75

Sequences

>TTHERM_00578560(coding)
ATGGCCACAACAACTAATATTCTTCATGACGTTGTTAGAGATTAGTCAATGGTAAATTAT
GTCTCAAATAGAGATAGACCACTCTATTTTAAGAGGCCTCTTGTGCCTCAAATGACAGAC
ATTCCTTTGCATATCTCTCGTCCTCCTGTAGATTAATAAGTGGATTATTAAACTATGTAG
ATGCAATAAAATGCTACCATAGTTGAGGCACCTACAAAAGATGCTTTTGTATAAACAGAT
TATAGAGAAAGTGAGACTTAAACTGATCCTTATACTCCTAAATGTTTTGTTCGTGATGGA
GATCATCCTGAGGTTATGGAATTAAAAGATTATAAGTATGGAAAGGGACTCCCTGCATCA
ATTGAAGAGTTAGAATAAATTGAATTAAATCGTGAAAAAGTGTGGTTTGAAAATTCCTTG
CCTCCCATTTCTGATGAAGCATCGTTTAATTTACGTCGTAAATTGATGGAAGAATAAGAA
CTACGTGAATGGAGCAAAAAAGAAAATGAAATAAAAAAATTCTAAAATGAGAAACTTTAT
TTGCTCCAATAGGCTTTAATTGAAAGAGAAAAAGAAGTCGAGGACAAGAGCTAAGAAAGA
ATAGAAGAAATCAGGTAATAAAAGACTGAGCACAAGAATAGATAGATTGCTAAGATTTAA
AGAAAAAAAATTAAAATTGACAGAAAGATGACTAAAAGCAGAAAAATGCAGGGTAAAGAG
ACTTTGAAGCGTGATATTATTGAAGATTATGCTAATTTTGCTTCTAGAGTTTACGCTGGT
ATTACTCACGAAGGTCTTTCTCTTGATAAGATAGCTAACAAATATGAAGTATAACCTCTA
GCATTAGGAAACTATGAAATGCTTCAAGCCCTCCATGAAGGTATTCGCCCAAGAGAGTTT
GAAACAAGAGTCAATCTCAAAAAGGAAATTAAGGAAATTGAAAAGAACTATACAAGATTG
GAAAATTATCATAGAGGCGAGCTTAAAAAGGCATAAGATGAAATTAATGGAGTTCATGAA
TAAAGCAAAGCCTAATAAAAATAAGAAGGAAACAACTTTTCTTACAGAAACTTCGAAAAC
AAAATTCGTCCTGCAACTCCTACTTGGAAATATGACACTGATTTTAACATTAGTCCTTCT
CTAATAACAGAAATTTAGGAGTACAGAGGTCCTAATGGTGTTTAATTGATGCAAGCTGCT
GATAAGAGGGAAGAAGCTGTTCTCCTTTTACAAAGATTGTTAAGAGGTAGAACTACTTAG
AATATAATGTACGAAGGTAAGAAAAAGCGTACTGCCCTTATTGAAGAATTGCTTACAGTA
GCTCAAATCGAAAACTTAGAGGAAGATAAAGCTGAAGAAGTGCTCATGTAACAACATGAA
GAAAAAGTTAAGAATGCTGTACTAGAAAGCATTTAAGGAGAAGTTATAGCTGAAACTATG
GATGAATTATCAAAGGAATTGCTTCGTATCAAGCAAGAAAGAAAGATATAGCAAATGGTT
GAAATAGCTGAAAAGGACAGAAGAATAAGAGAAATCGAGGAAGCTGGTAAAAGACAAGCA
GAAGAGATTCTTAGAGACCGTGAAGACGTTCTTCACAATTAACTTATCAGAGTTCATCAA
GGCACCGTAGATACATATTTAGATTGGTTGATGTCGAATGCTTTAGAACAATCTTCTGCA
AGACAAGCCACAATAATGACAAATTTAAGAAAGGCAAAATTCAACTTGCCTTTGGAGGAC
TTCGAAAGAAAATATAATAACAATCAAACTCTTATAAAGGATCTTGTACACTCATTCCTA
ATTCCAAACGTACAACGCTCCAAGCTTAAAAAATAAATTCAATTAGAGGAAAAGAGATTT
AGCGAGGCTGCTAAGAGATCTCTTCAACAAACAATAACCCGTGCATCAAATAAGCACGCA
AATGTTTAAAATTGA


>TTHERM_00578560(protein)
MATTTNILHDVVRDQSMVNYVSNRDRPLYFKRPLVPQMTDIPLHISRPPVDQQVDYQTMQ
MQQNATIVEAPTKDAFVQTDYRESETQTDPYTPKCFVRDGDHPEVMELKDYKYGKGLPAS
IEELEQIELNREKVWFENSLPPISDEASFNLRRKLMEEQELREWSKKENEIKKFQNEKLY
LLQQALIEREKEVEDKSQERIEEIRQQKTEHKNRQIAKIQRKKIKIDRKMTKSRKMQGKE
TLKRDIIEDYANFASRVYAGITHEGLSLDKIANKYEVQPLALGNYEMLQALHEGIRPREF
ETRVNLKKEIKEIEKNYTRLENYHRGELKKAQDEINGVHEQSKAQQKQEGNNFSYRNFEN
KIRPATPTWKYDTDFNISPSLITEIQEYRGPNGVQLMQAADKREEAVLLLQRLLRGRTTQ
NIMYEGKKKRTALIEELLTVAQIENLEEDKAEEVLMQQHEEKVKNAVLESIQGEVIAETM
DELSKELLRIKQERKIQQMVEIAEKDRRIREIEEAGKRQAEEILRDREDVLHNQLIRVHQ
GTVDTYLDWLMSNALEQSSARQATIMTNLRKAKFNLPLEDFERKYNNNQTLIKDLVHSFL
IPNVQRSKLKKQIQLEEKRFSEAAKRSLQQTITRASNKHANVQN


>TTHERM_00578560(gene)
ATGGCCACAACAACTAATATTCTTCATGACGTTGTTAGAGATTAGTCAATGGTAAATTAT
GTCTCAAATAGAGATAGGTAAATTTTTATTTGGCAAAATTATTAAAATCCACGCATCTTC
ATCAAGGCGCGATCAGATTGATTAAACTAACTGATAGTAAAGGGATCTTTAACAAACTTA
AAGAGAGACCAGCTTTAATAGATTATTAAAAGCATCAAAGATTTATAAAATATTTTTTTA
ATTTACTATAAATGGGAATAAGTTTTTTATTTATAAATATGATGAAGTTTCAGTTTTTAA
TACATTGATTTAGGATAAAACTTAAATATTTTCATTGCTTAAATATTTTATTATTAAAAA
TTAAATAATATAGACCACTCTATTTTAAGAGGCCTCTTGTGCCTCAAATGACAGACATTC
CTTTGCATATCTCTCGTCCTCCTGTAGATTAATAAGTGGATTATTAAACTATGTAGATGC
AATAAAATGCTACCATAGTTGAGGCACCTACAAAAGATGCTTTTGTATAAACAGATTATA
GAGAAAGTGAGACTTAAACTGATCCTTATACTCCTAAATGTTTTGTTCGTGATGGAGATC
ATCCTGAGGTTATGGAATTAAAAGATTATAAGTATGGAAAGGGACTCCCTGCATCAATTG
AAGAGTTAGAATAAATTGAATTAAATCGTGAAAAAGTGTGGTTTGAAAATTCCTTGCCTC
CCATTTCTGATGAAGCATCGTTTAATTTACGTCGTAAATTGATGGAAGAATAAGAACTAC
GTGAATGGAGCAAAAAAGAAAATGAAATAAAAAAGTAGAATATTTTATTTAAATATTTTA
TATAATTAATTAGATGATAGTCTATTCTTCTTAAGAAATGAAATTATTTCTGTTTAGATA
GATCAAGCAACTGATTTCAAGATAAAAACAAATTTATTTAATATCATTTTTGAAACGAAT
TTACAAGTTAAAAAATTTAGATTAGAAATGTTACAACTATTTTTGAAAGTAAAATGAATA
TCAACCCAATGACTATTATTACAAAACCATAAATTTGGTTCAAAGAAATGATTTTAATAA
GACATAAAACAAATATGAATTTAAATTTTACTAACAATTTCTATGAATTGTTAGCAAATT
TATGATAAAGAATAATGCTTCAATAAATAATCATTTATATAGAAAAATAAGTAATAAATA
ATTTGTATTTAAATAGATTCTAAAATGAGAAACTTTATTTGCTCCAATAGGCTTTAATTG
AAAGAGAAAAAGAAGTCGAGGACAAGAGCTAAGAAAGAATAGAAGAAATCAGGTAATAAA
AGACTGAGCACAAGAATAGATAGATTGCTAAGATTTAAAGAAAAAAAATTAAAATTGACA
GAAAGATGACTAAAAGCAGAAAAATGCAGGGTAAAGAGACTTTGAAGCGTGATATTATTG
AAGATTATGCTAATTTTGCTTCTAGAGTTTACGCTGGTATTACTCACGAAGGTCTTTCTC
TTGATAAGATAGCTAACAAAGTAAGCAAATTTATAATTTTTATAATCATAATTATAATTT
CAACTAAAATTAGTATGAAGTATAACCTCTAGCATTAGGAAACTATGAAATGCTTCAAGC
CCTCCATGAAGGTATTCGCCCAAGAGAGTTTGAAACAAGAGTCAATCTCAAAAAGGAAAT
TAAGGAAATTGAAAAGAACTATACAAGATTGGTAATTACTAAATTTTATATATAATAAAA
AAGTAAAATTTTAAATAATATTTTTATTAATATTAGGAAAATTATCATAGAGGCGAGCTT
AAAAAGGCATAAGATGAAATTAATGGAGTTCATGAATAAAGCAAAGCCTAATAAAAATAA
GAAGGAAACAACTTTTCTTACAGAAACTTCGAAAACAAAATTCGTCCTGCAACTCCTACT
TGGAAATATGAGTAAATAAATTAATCATTTAAAAATTTAAAATAAAAATAATGAAAATTA
TTTATTAAAATAGCACTGATTTTAACATTAGTCCTTCTCTAATAACAGAAATTTAGGAGT
ACAGAGGTCCTAATGGTGTTTAATTGATGCAAGCTGCTGATAAGAGGGAAGAAGCTGTTC
TCCTTTTACAAAGATTGTTAAGAGGTAGAACTACTTAGAATATAATGTACGAAGGTAAGA
AAAAGCGTACTGCCCTTATTGAAGAATTGCTTACAGTAGCTCAAATCGAAAACTTAGAGG
AAGATAAAGCTGAAGAAGTGCTCATGTAACAACATGAAGAAAAAGTTAAGAATGCTGTAC
TAGAAAGCATTTAAGGAGAAGTTATAGCTGAAACTATGGATGAATTATCAAAGGAATTGC
TTCGTATCAAGCAAGAAAGAAAGATATAGCAAATGGTTGAAATAGCTGAAAAGGACAGAA
GAATAAGAGAAATCGAGGAAGCTGGTAAAAGACAAGCAGAAGAGATTCTTAGAGACCGTG
AAGACGTTCTTCACAATTAACTTATCAGAGTTCATCAAGGCACCGTAGATACATATTTAG
ATTGGTTGATGTCGAATGCTTTAGAACAATGTAAATATAAAATAAAATCATTTAAAAAAT
TAATTAATTGATTGAAATTAAAGTTTTTTTTGTTTTTATCTTAAATATTATTTTATTTAA
TATTAATCTTTAAATTAATTTTAATTTAATAAAAAGCTTCTGCAAGACAAGCCACAATAA
TGACAAATTTAAGAAAGGCAAAATTCAACTTGCCTTTGGAGGACTTCGAAAGAAAATATA
ATAACAATCAAACTCTTATAAAGGATCTTGTACACTCATTCCTAATTCCAAACGTACAAC
GCTCCAAGCTTAAAAAATAAAGTAAATTTTTAATTTAAAAATTAAATTTTAAAGTTAATT
AACAATTATAGTTCAATTAGAGGAAAAGAGATTTAGCGAGGCTGCTAAGAGATCTCTTCA
ACAAACAATAACCCGTGCATCAAATAAGCACGCAAATGTTTAAAATTGA