Identifiers and Description

Gene Model Identifier

TTHERM_00641200

Standard Name

FAP61 (homolog of the Chlamydomonas CSC protein FAP61)

Aliases

PreTt10588 | 92.m00130

Description

calmodulin and spoke-associated complex (CSC) protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01612 ) rhoptry protein
  • ( PF05162 ) Ribosomal protein L41
  • ( TIGR01147 ) V-type ATPase, G subunit
  • ( PF00070 ) Pyridine nucleotide-disulphide oxidoreductase
  • ( PF07992 ) pyridine nucleotide-disulphide oxidoreductase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00641200

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_116790
Tetrahymena borealisEI9_05195.19.997093137033517e-262hypothetical protein (1700 aa)
OxytrichaContig1193.0.g29.997093137033517e-262Pyridine nucleotide-disulphide
oxidoreductase

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25694453: Urbanska P, Song K, Joachimiak E, Krzemien-Ojak L, Koprowski P, Hennessey T, Jerka-Dziadosz M, Fabczak H, Gaertig J, Nicastro D, Wloga D (2015) The CSC proteins FAP61 and FAP251 build the basal substructures of radial spoke 3 in cilia. Molecular biology of the cell 26(8):1463-75

Sequences

>TTHERM_00641200(coding)
ATGTACTCCAACAATTAATTAGATAATCCAAATCACTCGAGGAGTCAATATAGGAACGGA
GATCAAAGTGGAATTTATGCTGGATCAGATGAAGAATTTTAGGTCCTCGTTAGGAAAAGC
GACTTAGACGATGTAGATGAAGTGTTGAAGATAATCGCATAGCATGAAAGAGAAGCAAAT
GACTTACTCTACGACTATCCTAATCTGCTCAGTCTCTTCGAAAAAAATTATTTGAGTGTA
ACTATCTTGAACCAGTAATAATAGATAATAGGTGCTGCAGTTTTTAACGATTTTCCTCAA
GGACTTACAGGATAGATTGATTTCTAGCACGAAAACTTCTGGGAAAATTGGATCTTTGAT
GCTTTTAATTTTGATGAAAGCATTTGTATCACTCCATTTAACACTTTATGGATGACTTTC
TTCTTTGTAGCAAAGGATTAATACAAATTTAGTCAAGAAGAAGAGCTGATAATTTGTTAA
AAAGTATTTTAAAATGTATACGCTACACTTCCTCAGTTAGAAGGTATTCTCTTCTTAAAA
AGAGGTGAAACTATGGAAGATAATGGAGCTTAAGCATAAATATCAAGCATTTTGGAAAAC
ATTTTTATTGAAGTTCCTGTGAAAGACAGAGATATTATTAAGAGAGTAAGAGGTATCCAC
TTGAATTCTGAGGTATTCTATTCTCCAAAGCATGCTTGCTAAGAAATTATTGAAATCAGA
ATGGCTCGTGAGTAAGATCATGATGATTTAGCTGAAATCTTTAACAGATAGAGTGAAGTA
TTGACTGCTCAGTTTGGTGAATTCTTTATTGCTGATTTGATTGCCACATAAAACTTAACA
CGTAGAGGAACTCGTAAATTTTTAAATAATGGTAAAGCAATTGTTGGTCAAGTAAGAGAT
AAAGCTGTTGGTTTGATGAGTATTTCAACTGATATTGACTACAAATTTTTGGCTCAATGC
TTTGAATTAGAGACTTATGATAATTTGTTTAAGCCTGATTTCATGGAAGCTATATAAAAT
AAAAGAGATGATATTAGAAGAGAAAATTAATATAGAGAGGAAGACTAATATCAAGAAATA
GTTAAAAAGATGAACGAAGAAAGAATGAAGAGTCATTTTATTGGTTAAAGAATGACTCTT
TAACAACACTGTAGAGAAAAGGAATAAGAAATCGTTATGAAAATCGATGAAATAATTAAT
AATGATGCTATCTAAAAGAATCTTACTAAAAAGTAAGTTGAAGAATTCTTAGACGAATGG
TTAAGAGGTTATGAGTTGCACTAGCCATCTGATCTTTTTTACCAATATCCTCATATTTTC
CCTAATACATAATCAATCATTCTCACTCCTAGGTAGCTTTTAATTGAGACTCTCGAGTTT
TTCGGACTTCCTTAACATTATATGAATGGAGCTGGACACTGGAAGGATTGGGTCCAAAAG
AAAATGGAAGAAAAGAGAATAGCTCAACTTAAGAGACCTTAGAAGAAAGTTACAAAGAGA
CCAAAAAGATAGAAAGAAGAAGATAAAAAAGAAGATGAGTTCAAGCCTCCAAGTTATTTT
GATCTAACTCCTTTCTAAAGCGCCTTTAAGAAATTTTTGGCTGTAAATCCCGAAGGCCGT
ACTATTTTTAGATAAAAAATAGAAGCTAGTATGAAAGTCATTAAAATGATGTTCTGTAAT
GAAAATGGAGAAATGAAAGAAGAAAGACACGTAGATCTCAATGATTTAGGAAATGAACTC
AATAAATAAAAAATGGATATTGCTCCAGAAGTTTGTGAGAATTTGGCTTCATTTTTAGAA
TGCTTTGGTGAAATAAAGTATGAAGAAGAAATTATTATGGTCAATCCTCCAAAAGAAGAT
ACCAATCAAAATGCTAAGATAGCTCAAACTAAAAAAATGTTTGCTTCTGAGTAAACTGAA
TCAAAGCCCATTCCTAAATTACTTAAAAAAACATCCTTTTAAGAATTCTTTGATGCAGTT
TATAAAATGAAAGAGTTCGATATTATGATGAATAGATTAGATATTACAAAAAGCACTACT
TTAAAGGCAGAAGTTAGCTAGATTGTAAAAGAAGAAGCTCAATAAGAAAAGGCTAAGCAA
GAAAAGAGAAGGATTGAGAGATCTCCTAATCCTTATGATGATTATGTAAAGAATCTAAAG
GATTTAGATAGCATTCCAGAAGTTCCTATAGACGCATAAAATGCGATTGTCATAAATTTG
TTTTGTATTGATGAAAATTTTGAGAGTAGGTCACTTGATTTTGTAGAATATGCTTTTAGT
ATTTTTGGTGACAGGGACTATATCATATTAACTCAACCTTTTACTGTACCTGAAACTACA
TTACTTTAGCAATTCATTAAAATTCCCATGAAGAAAAATAGTACTTTTGATCACGTTTTA
TACATTTATCATAAAGATTGTTTACTCAGTAATACCTTGTTCATAAGAAAGAGTAAGCTT
GAAGATATGTAATATGTTGCTCCCTTGTTCTCTAATTTAATTAATAAGTAACAGATATAT
GATGATACTTTGGAAGCTATCACATAAACTGCTTCTAGAAAAGTTGCATTTTCTGTCTTC
TGTGACTAATCGCTAATTGGTATTTACGTGGTATCTAAGAACGTTAATTTAGATTATTAC
ATTTCTCATTTCTGTGTATAAGATCATATAATTTTAAAAGAGCATCCTATGACATGCCAT
ACAAAATTAATCCATACTGCTTTGAATCCTCTATTTACCAAAAACACTAGGTTCATCCTT
AAAGAAATATTACGTTTAATGAATAAGACTTGCATGTATTTCGAAGTTCAAGAAAAGACT
TTGCTTCCTGATGTATTTAATGAATTAGTTTTTGTTCGTGCAAGATAATTCCCACATTTC
CTTAAAAGAAAATGGGACTTTGAACATGATAAAGAACATTTTGAGCGTGCTGGAGACCTA
ACTGAAGTCTAAGATGGAAAAAGAGATGCATTTGACTAAGAACAAGCTCCATTTTCTTTA
TCAGTCATCACTAAAAAAATGATGAGTAGCGTAAAGGTTAATAATAATACAAGAATTGTT
GTGGTTGGTGCTTCTGATACAGGCATTTCATTTATAGAAAGCTTACTTTCAGTAAAGGAT
ATTAATTTTACTCACATAACTTTACTTGCTCCTGGTGGCATTATGACTATGCACATTAAT
CTGCCTGGAGACTAGTTAAAGGCTTTATCGACAAACTATACTCTAGAAGAATTAAAAAAT
TTAATGCTTGATGCAAGAGTTAACGTTTTAGATGCAAAAATGGTAGAGTTAGATAAGAAG
GGCAAAAAGATAAAATTGGATAAAAATGCTGAACTTCCTTATGATTACTTGGTGAACACT
GTAGGATTAATTGATACAGAATTATAAAATAGAAGACTTATCTCCACAGGTTTATTCTCA
TCTCCATATTACTAACAACTCTTGGATAAGTATGGAAGAGATCGTGCATAAATTGAAGAA
GGGGCACCTCCTATTTTTGGCCAACATCCTGTTTATGGAAATTACGTATAAGGTGTTTAT
AGCATAGATGATCCATACCTCTACGAAGAATTCAAGAAAACAGGAAAGAAAGACTCTAAC
ATTGATTTGTTGACTCGTAAAAAGAGACCTCAAAGTATTACTATATACGGAAGAACATTG
CACACTATTGCTTTTATCTCTGGTATGGTCAATCGTGGCGTACATCCCAATAGAATTCAT
TATGTTATTCCTCCTAAAGTTTTTGAAACTCAAGTTCAATTTAAGAATAACACTGAGAGA
TTAATTTATGAAGATAAGAGAATCAACGATCCAGATCCATTCGATGATCCTTCAGTTGAG
TAAAAGATCTTTGAATTTATGGAATCAAAAGGAATCTAAGTTCATAAGGGATACAATCTC
CATTAAATTGATGTTGATGAAGAAACAAGAATTTGTTAGGGAGTGGTATTCCGTAAAAAA
GCAGATAATTATGAAGAAATTATTTAGCAAATTGAAATAAAGAAATAGCAAATATTAGAG
CGCGATGCCAACAGCGAGAATGCTGACAAGGGATTTGATGATACCCAAAGTCGTGATGGC
GATGAAGAAAATCAACCAATAACTCTTGAATAAGAAATAGAAGAACTAGAAAGAAATAAA
TTTGATGATATTGAAATTACATCTCGTTTTTTAGTAACTTCAGGTTTAGTTGATATTGAC
AAAGAAATCTTTTATATTATTCACGAAAATGGTTTAGTATATAATGGTCGTTTAATTGTT
AAGTCAAACTTTTAAACTACTGAAAAAGACATCTTTTGTTGTGGTAAAATCTGTGAATTC
TCTCAGAGATACAAGAGGCTTTCTATAGGAAGATCTCTCCGTTTAGACAAATATAATGGA
CGTGAACTAGGTCAAAAATTAGCTAAGTGTCTCTTAGATAGCTTGGACTTAGGATATCTT
ACAGATTAAATTTATAGCTTGGGAGAACTTCCAAATCTCTATATGCCAATTGGAATAGGA
GCATTCCTACCAGGAGATTTGTTCTATTATCACATAAAAAAGAACGACTATGCTAGACCA
AGCAAAACCATGGAGGCAGAGGATAATAGACAAGACATTGTTTCTGACAATATTGATCAA
AAATAACAAATTGGACATTATATTAAATTTAAATTTGATAATAATGGAATCATTGATTAA
GTGACATACTTGGGCACTGAACCTGTATCTGTTTAAAGTCTAGTTTCTTTTGTAGGTTTA
TCAGAAAAATGCCTCAACCAATTAGATGTGCGTTTCAAGAACGGCCTTATTCCAAATATT
TCTGAGTTCTTAAGTGAAAACTGGGCCATAGGTCTCTATCATGAGTGGTTCAGCGAATTT
AGACACATTACAAAAATGGAAATGCTCCAATCTGAAAATATTTAATAAATTTTAGATGAG
GCTGCCAAATATGCTCAAGGTGGTGGCTTCCTTGATCCTGAGTTTATTGAAAAAATAAAA
GCCAAAATATCTCCAGAAATAATAAGTTAAATATAATAAGGAACTTTAGATTTTATTAGA
GAAAATTAAAACCATTTGCCAATGTATTATGTACCTCCTAAAAAAGTAAATGTAGATTGA


>TTHERM_00641200(protein)
MYSNNQLDNPNHSRSQYRNGDQSGIYAGSDEEFQVLVRKSDLDDVDEVLKIIAQHEREAN
DLLYDYPNLLSLFEKNYLSVTILNQQQQIIGAAVFNDFPQGLTGQIDFQHENFWENWIFD
AFNFDESICITPFNTLWMTFFFVAKDQYKFSQEEELIICQKVFQNVYATLPQLEGILFLK
RGETMEDNGAQAQISSILENIFIEVPVKDRDIIKRVRGIHLNSEVFYSPKHACQEIIEIR
MAREQDHDDLAEIFNRQSEVLTAQFGEFFIADLIATQNLTRRGTRKFLNNGKAIVGQVRD
KAVGLMSISTDIDYKFLAQCFELETYDNLFKPDFMEAIQNKRDDIRRENQYREEDQYQEI
VKKMNEERMKSHFIGQRMTLQQHCREKEQEIVMKIDEIINNDAIQKNLTKKQVEEFLDEW
LRGYELHQPSDLFYQYPHIFPNTQSIILTPRQLLIETLEFFGLPQHYMNGAGHWKDWVQK
KMEEKRIAQLKRPQKKVTKRPKRQKEEDKKEDEFKPPSYFDLTPFQSAFKKFLAVNPEGR
TIFRQKIEASMKVIKMMFCNENGEMKEERHVDLNDLGNELNKQKMDIAPEVCENLASFLE
CFGEIKYEEEIIMVNPPKEDTNQNAKIAQTKKMFASEQTESKPIPKLLKKTSFQEFFDAV
YKMKEFDIMMNRLDITKSTTLKAEVSQIVKEEAQQEKAKQEKRRIERSPNPYDDYVKNLK
DLDSIPEVPIDAQNAIVINLFCIDENFESRSLDFVEYAFSIFGDRDYIILTQPFTVPETT
LLQQFIKIPMKKNSTFDHVLYIYHKDCLLSNTLFIRKSKLEDMQYVAPLFSNLINKQQIY
DDTLEAITQTASRKVAFSVFCDQSLIGIYVVSKNVNLDYYISHFCVQDHIILKEHPMTCH
TKLIHTALNPLFTKNTRFILKEILRLMNKTCMYFEVQEKTLLPDVFNELVFVRARQFPHF
LKRKWDFEHDKEHFERAGDLTEVQDGKRDAFDQEQAPFSLSVITKKMMSSVKVNNNTRIV
VVGASDTGISFIESLLSVKDINFTHITLLAPGGIMTMHINLPGDQLKALSTNYTLEELKN
LMLDARVNVLDAKMVELDKKGKKIKLDKNAELPYDYLVNTVGLIDTELQNRRLISTGLFS
SPYYQQLLDKYGRDRAQIEEGAPPIFGQHPVYGNYVQGVYSIDDPYLYEEFKKTGKKDSN
IDLLTRKKRPQSITIYGRTLHTIAFISGMVNRGVHPNRIHYVIPPKVFETQVQFKNNTER
LIYEDKRINDPDPFDDPSVEQKIFEFMESKGIQVHKGYNLHQIDVDEETRICQGVVFRKK
ADNYEEIIQQIEIKKQQILERDANSENADKGFDDTQSRDGDEENQPITLEQEIEELERNK
FDDIEITSRFLVTSGLVDIDKEIFYIIHENGLVYNGRLIVKSNFQTTEKDIFCCGKICEF
SQRYKRLSIGRSLRLDKYNGRELGQKLAKCLLDSLDLGYLTDQIYSLGELPNLYMPIGIG
AFLPGDLFYYHIKKNDYARPSKTMEAEDNRQDIVSDNIDQKQQIGHYIKFKFDNNGIIDQ
VTYLGTEPVSVQSLVSFVGLSEKCLNQLDVRFKNGLIPNISEFLSENWAIGLYHEWFSEF
RHITKMEMLQSENIQQILDEAAKYAQGGGFLDPEFIEKIKAKISPEIISQIQQGTLDFIR
ENQNHLPMYYVPPKKVNVD


>TTHERM_00641200(gene)
ATGTACTCCAACAATTAATTAGATAATCCAAATCACTCGAGGAGTCAATATAGGAACGGA
GATCAAAGTGGAATTTATGCTGGATCAGATGAAGAATTTTAGGTCCTCGTTAGGAAAAGC
GACTTAGACGATGTAGATGAAGTGTTGAAGATAATCGCATAGCATGAAAGAGAAGCAAAT
GACTTACTCTACGACTATCCTAATCTGCTCAGTCTCTTCGAAAAAAATTATTTGAGTGTA
ACTATCTTGAACCAGTAATAATAGATAATAGGTGCTGCAGTTTTTAACGATTTTCCTCAA
GGACTTACAGGATAGATTGATTTCTAGCACGAAAACTTCTGGGAAAATTGGATCTTTGAT
GCTTTTAATTTTGATGAAAGCATTTGTATCACTCCATTTAACACTTTATGGATGACTTTC
TTCTTTGTAGGTAAAAAATATATAAATAACTACATTAGATAATCTTTAAATTTCAAAAGC
ATTGAATTCATAAATAAATTGAGTAAAGCTTGTTTGTTTTTATTGCAAGAGAGAGGAAAA
TTTAGAAATGGTTCAAAATAAATTAAAGGAAAGTTGAGAAAGTCAAGAAAAGCACATTAT
TAAATAGAAATTAAACAAGTTTATTTACTTTTTGAATGAATAAATAATGCTTTTGAATAA
TAAATTATTAATTATTAAAATGAAATATAATTTGTTATAAATAACAGCAAAGGATTAATA
CAAATTTAGTCAAGAAGAAGAGCTGATAATTTGTTAAAAAGTATTTTAAAATGTATACGC
TACACTTCCTCAGTTAGAAGGTATTCTCTTCTTAAAAAGAGGTGAAACTATGGAAGATAA
TGGAGCTTAAGCATAAATATCAAGCATTTTGGAAAACATTTTTATTGAAGTTCCTGTGAA
AGACAGAGATATTATTAAGGTAGAAATTATTTTAACAAAAATTTTGAATATATTCACGCC
TTTTAAATCAGCATTTTCCTATTTAAAAACAAAAAGCGAAATTGAAATCTTTGAAAAATT
AGAAAATTATAAGTAACAACTTTAATGTTGTATCTTTTTTCAAAAAGGAAACGGTTATTA
ATCAATTAATTTATAAACAACAAAAATTAAATTAATGAAATAATTAATCAAAGGTGTTTT
TAAATTAATTCTTTTCAAATCTTATTTTAAAAATTCAAATACTTATGAAATATTTTAATT
AAAGCCGTTAATTAAAACATTTAATTTTGTTTGTAAAATTAATATAAAAATTTTAAAAAC
TTTGACTGATTTCTTGTTTTAATAATTAATTTTGAAATTAAATAGAGAGTAAGAGGTATC
CACTTGAATTCTGAGGTATTCTATTCTCCAAAGCATGCTTGCTAAGAAATTATTGAAATC
AGAATGGCTCGTGAGTAAGATCATGATGATTTAGCTGAAATCTTTAACAGATAGAGTGAA
GTATTGACTGCTCAGTTTGGTGAATTCTTTATTGCTGATTTGATTGCCACATAAAACTTA
ACACGTAGAGGAACTCGTAAATTTTTAAATAATGGTAAAGCAATTGTTGGTCAAGTAAGA
GATAAAGCTGTTGGTTTGATGAGTATTTCAACTGATATTGAGTAAATTTAAATAAATAAA
TTTTGTTTTCTTTTTGGATTTACCTTTTTAAATAAAATAAAATTAAAGCTACAAATTTTT
GGCTCAATGCTTTGAATTAGAGACTTATGATAATTTGTTTAAGCCTGATTTCATGGAAGC
TATATAAAATAAAAGAGATGATATTAGAAGAGAAAATTAATATAGAGAGGAAGACTAATA
TCAAGAAATAGTTAAAAAGATGAACGAAGAAAGAATGAAGAGTCATTTTATTGGTTAAAG
AATGACTCTTTAACAACACTGTAGAGAAAAGGAATAAGAAATCGTTATGAAAATCGATGA
AATAATTAATAATGATGCTATCTAAAAGAATCTTACTAAAAAGTAAGTTGAAGAATTCTT
AGACGAATGGTTAAGAGGTAATTAAAATTATTTACGAATTAATTTCTTATTCATTCATAA
TTATTATATATTTTGTTTTTAGGTTATGAGTTGCACTAGCCATCTGATCTTTTTTACCAA
TATCCTCATATTTTCCCTAATACATAATCAATCATTCTCACTCCTAGGTAGCTTTTAATT
GAGACTCTCGAGTTTTTCGGACTTCCTTAACATTATATGAATGGAGCTGGACACTGGAAG
GATTGGGTCCAAAAGAAAATGGAAGAAAAGAGAATAGCTCAACTTAAGAGACCTTAGAAG
AAAGTTACAAAGAGACCAAAAAGATAGAAAGAAGAAGATAAAAAAGAAGATGAGTTCAAG
CCTCCAAGTTATTTTGATCTAACTCCTTTCTAAAGCGCCTTTAAGAAATTTTTGGCTGTA
AATCCCGAAGGCCGTACTATTTTTAGATAAAAAATAGAAGCTAGTATGAAAGTCATTAAA
ATGATGTTCTGTAATGAAAATGGAGAAATGAAAGAAGAAAGACACGTAGATCTCAATGAT
TTAGGAAATGAACTCAATAAATAAAGTAAGCAATTAATTTTAAAAGATGATTTTTATTTA
TTTATTTATTTATTTATTTAATTTAAACAAGAAATGGATATTGCTCCAGAAGTTTGTGAG
AATTTGGCTTCATTTTTAGAATGCTTTGGTGAAATAAAGTATGAAGAAGAAATTATTATG
GTCAATCCTCCAAAAGAAGATACCAATCAAAATGCTAAGATAGCTCAAACTAAAAAAATG
TTTGCTTCTGAGTAAACTGAATCAAAGCCCATTCCTAAATTACTTAAAAAAACATCCTTT
TAAGAATTCTTTGATGCAGTTTATAAAATGAAAGAGTTCGATATTATGATGAATAGATTA
GATATTACAAAAAGCACTACTTTAAAGGCAGAAGTTAGCTAGATTGTAAAAGAAGAAGCT
CAATAAGAAAAGGCTAAGCAAGAAAAGAGAAGGGTAATTAATTCATTTTTTTTATTCGAA
TACAAATACTTGTAAATATTTATTTATCCATGTTAAAATTTAATCAAAGAAGTTTTTATT
CATTCTAATAATTTAATCAAAATATAAATAAATATGCTGCAAATTTAATCAAAGAAACGA
GCTGAAAATTTAATCAACTGAACATGCTAAAAACTTAATCTAAACAAATTTTTTTGAAAT
ACAAATTAAGGAAATGAATTAAAAATAAATGAATTTGAATAAATTTAAATTGATAAAAAA
AGCTTTGAAATTTGAATAATAAAATTAAATTGTTGAGAATTGAATTTAAAAAGTATTTAT
TTATTTATAAAGATTGAGAGATCTCCTAATCCTTATGATGATTATGTAAAGAATCTAAAG
GATTTAGATAGCATTCCAGAAGTTCCTATAGACGCATAAAATGCGATTGTCATAAATTTG
TTTTGTATTGATGAAAATTTTGAGAGTAGGTCACTTGATTTTGTAGAATATGCTTTTAGT
ATTTTTGGTGACAGGGACTATATCATATTAACTCAACCTTTTACTGTACCTGAAACTACA
TTACTTTAGCAATTCATTAAAATTCCCATGAAGAAAAATAGTACTTTTGATCACGTTTTA
TACATTTATCATAAAGATTGTTTACTCAGTAATACCTTGTTCATAAGAAAGAGTAAGCTT
GAAGATATGTAATATGTTGCTCCCTTGTTCTCTAATTTAATTAATAAGTAACAGATATAT
GATGATACTTTGGAAGCTATCACATAAACTGCTTCTAGAAAAGTTGCATTTTCTGTCTTC
TGTGACTAATCGGTAAATCAATTTTTTAAAAAATTTTTTATATAAATATTTTTTTTCTTC
TGAATTTCAACAGCTAATTGGTATTTACGTGGTATCTAAGAACGTTAATTTAGATTATTA
CATTTCTCATTTCTGTGTATAAGATCATATAATTTTAAAAGAGCATCCTATGACATGCCA
TACAAAATTAATCCATACTGCTTTGAATCCTCTATTTACCAAAAACACTAGGTTCATCCT
TAAAGAAATATTACGTTTAATGAATAAGGTAAATTTTTAATTATCTCATTAAATAAAAAT
AATAAAATTCAATTAAATTTTTATTAGACTTGCATGTATTTCGAAGTTCAAGAAAAGACT
TTGCTTCCTGATGTATTTAATGAATTAGTTTTTGTTCGTGCAAGATAATTCCCACATTTC
CTTAAAAGAAAATGGGACTTTGAACATGATAAAGAACATTTTGAGCGTGCTGGAGACCTA
ACTGAAGTCTAAGATGGAAAAAGAGATGCATTTGACTAAGAACAAGCTCCATTTTCTTTA
TCAGTCATCACTAAAAAAATGATGAGTAAAAAATTAATTAACTTGATATTTTTTATTTTC
TGCAATTTTGTTTCTGATTTTAATTAAAATTTTATTCAAAATAAAATTAATTTTTTTATT
TAAATTAATAAACATTTTATTCAAAATAAAATTAATTTTTATATTTAAATTAATAAAGGT
AGCGTAAAGGTTAATAATAATACAAGAATTGTTGTGGTTGGTGCTTCTGATACAGGCATT
TCATTTATAGAAAGCTTACTTTCAGTAAAGGATATTAATTTTACTCACATAACTTTACTT
GCTCCTGGTGGCATTATGACTATGCACATTAATCTGCCTGGAGACTAGTTAAAGGCTTTA
TCGACAAACTATACTCTAGAAGAATTAAAAAATTTAATGCTTGATGCAAGAGTTAACGTT
TTAGATGCAAAAATGGTAGAGTTAGATAAGAAGGGCAAAAAGATAAAATTGGATAAAAAT
GCTGAACTTCCTTATGATTACTTGGTGAACACTGTAGGATTAATTGATACAGAATTATAA
AATAGAAGACTTATCTCCACAGGTTTATTCTCATCTCCATATTACTAACAACTCTTGGAT
AAGTATGGAAGAGATCGTGCATAAATTGAAGAAGGGGCACCTCCTATTTTTGGCCAACAT
CCTGTTTATGGAAATTACGTATAAGGTGTTTATAGCATAGATGATCCATACCTCTACGAA
GAATTCAAGAAAACAGGAAAGAAAGACTCTAACATTGATTTGTTGACTCGTAAAAAGAGA
CCTCAAAGTATTACTATATACGGAAGAACATTGCACACTATTGCTTTTATCTCTGGTATG
GTCAATCGTGGCGTACATCCCAATAGAATTCATTATGTTATTCCTCCTAAAGTTTTTGAA
ACTCAAGTTCAATTTAAGAATAACACTGAGAGATTAATTTATGAAGATAAGAGAATCAAC
GATCCAGATCCATTCGATGATCCTTCAGTTGAGTAAAAGATCTTTGAATTTATGGAATCA
AAAGGAATCTAAGTTCATAAGGGATACAATCTCCATTAAATTGATGTTGATGAAGAAACA
AGAATTTGTTAGGGAGTGGTATTCCGTAAAAAAGCAGATAATTATGAAGAAATTATTTAG
CAAATTGAAATAAAGAAATAGCAAATATTAGAGCGCGATGCCAACAGCGAGAATGCTGAC
AAGGGATTTGATGATACCCAAAGTCGTGATGGCGATGAAGAAAATCAACCAATAACTCTT
GAATAAGAAATAGAAGAACTAGAAAGAAATAAATTTGATGATATTGAAATTACATCTCGT
TTTTTAGTAACTTCAGGTTTAGTTGATATTGACAAAGAAATCTTTTATATTATTCACGAA
AATGGTTTAGTATATAATGGTCGTTTAATTGTTAAGTCAAACTTTTAAACTACTGAAAAA
GACATCTTTTGTTGTGGTAAAATCTGTGAATTCTCTCAGAGATACAAGAGGCTTTCTATA
GGAAGATCTCTCCGTTTAGACAAGTAATAATTATTTTTGAAAATATCATATAAACTAATT
TGTTATAAATTATAAGATATAATGGACGTGAACTAGGTCAAAAATTAGCTAAGTGTCTCT
TAGATAGCTTGGACTTAGGATATCTTACAGATTAAATTTATAGCTTGGGAGAACTTCCAA
ATCTCTATATGCCAATTGGAATAGGAGCATTCCTACCAGGAGATTTGTTCTATTATCACA
TAAAAAAGAACGACTATGCTAGACCAAGCAAAACCATGGAGGCAGAGGATAATAGACAAG
ACATTGTTTCTGACAATATTGATCAAAAATAACAAATTGGACATTATATTAAATTTAAAT
TTGATAATAATGGAATCATTGATTAAGTGACATACTTGGTAAACTCTTTAATTAAAGTTA
AAAACTTTCTAAATTATTTTTAATTCCATCTAGGGCACTGAACCTGTATCTGTTTAAAGT
CTAGTTTCTTTTGTAGGTTTATCAGAAAAATGCCTCAACCAATTAGATGTGCGTTTCAAG
AACGGCCTTATTCCAAATATTTCTGAGTTCTTAAGTGAAAACTGGGCCATAGGTCTCTAT
CATGAGTGGTTCAGCGAATTTAGACACATTACAAAAATGGAAATGCTCCAATCTGAAAAT
ATTTAATAAATTTTAGATGAGGCTGCCAAATATGCTCAAGGTGGTGGCTTCCTTGATCCT
GAGTTTATTGAAAAAATAAAAGCCAAAATATCTCCAGAAATAATAAGTTAAATATAAGTA
AACAAACATTTATTTTTATTAATTTATTGAAGATTTTTAATCTAAAATTCATCAAAATAA
TATCTAATTTTATTTATAAATAAAATTAATAGTAAGGAACTTTAGATTTTATTAGAGAAA
ATTAAAACCATTTGCCAATGTATTATGTACCTCCTAAAAAAGTAAATGTAGATTGA