Identifiers and Description

Gene Model Identifier

TTHERM_01262850

Standard Name

FAP251 (homolog of the Chlamydomonas CSC protein FAP251)

Aliases

PreTt01683 | 298.m00024

Description

calmodulin and spoke-associated complex (CSC) protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02210 ) Laminin G domain
  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF02762 ) CBL proto-oncogene N-terminus, SH2-like domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12%

TetraMine Data

TTHERM_01262850

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_150090
Tetrahymena borealisEI9_21053.19.997093137033517e-262hypothetical protein (972 aa)
OxytrichaContig21434.0.g69.997093137033517e-262WD domain, G-beta repeat
DictyBaseDDB_G02691040.0000009995106777214876calB on chromosome: 1 position
2981116 to 2981944
WormBaseWBGene000005520.00003998524687536623locus:cmd-1 Calmodulin sta
tus:Confirmed UniProt:O16305
protein_id:CCD69969.1
SGDYBR109C0.0002999184360822198CMD1 Calmodulin; Ca++ binding
protein that regulates Ca++ in
dependent processes (mitosis,
bud growth, actin organization
, endocytosis, etc.) and Ca++
dependent processes (stress-ac
tivated pathways), targets inc
lude Nuf1p, Myo2p and calcineu
rin

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25694453: Urbanska P, Song K, Joachimiak E, Krzemien-Ojak L, Koprowski P, Hennessey T, Jerka-Dziadosz M, Fabczak H, Gaertig J, Nicastro D, Wloga D (2015) The CSC proteins FAP61 and FAP251 build the basal substructures of radial spoke 3 in cilia. Molecular biology of the cell 26(8):1463-75

Sequences

>TTHERM_01262850(coding)
ATGTATTAGTAAGAAGAATACGAAGTTAACAATGAAGGCTAAGAAGATGTTAGCAAGATA
AATGCATTAAATTTGAAATGGACTTTAGGTTTTAATTTCTAGCTCACTGATGGCGTTCAC
AATTTAACAAATGAAAAAAGAAAAGAAATTTTCTATCCTGTTGCGCACACTGGTGTTATA
TACGATTATGAAAACAATACATAAAGATTATTATAGGGTCATTGTAATAGAATTACAGCA
ACAGCATATTGCAAATTCTCAGATATAATTGTTACTGCTGACTGCGGTCCAGATTCTATG
TTAGTAGTCTGGGATGCATCAACAGGTATTCCTAAAAAGACTATCTTTGAACCACATCCT
AATGGTTGTTAAGCTTTAGATATTTCTCAAGATGGACAATTCATCGTGACTCTTTCAAAA
GAAGCTAATACAGATACTGATGTATAATCTCTTTCTTTGTGGGAGTGGAATAAAGATGAT
GAACCATGTTTGATTACCAATGAATTCGATAGAAGAATTAAGGATTATTAATATTTCGTT
AGATTCAATTCAGATGATAACACTGAATTTGCAACAACTGGTAAGACAAGAATTGTTTTT
TGGAGAAGAGAAGGAGAATAAAAAGGTTTTAACTATTATTCCCCTGGTAACATTCCATCT
CTTAAGGTTCTCACTCAAACAGTATTTATACCTGATAATACATAGGTTGTTACAGGAACA
ACTGATGGTCATATTATTGTATGGGATATTTCTCTTATCATAGAAAAAGTAGACACTCCA
AAAGAAAGAAGAGCAATTAAATTGGTTGATCTTATGAATAAATCAAAAAAGCCTGATGGC
AAAAAAGGATCAAATTCAATTAATATATTAAAAATTTAAGATAACTATTTAGTTATTGGT
TCATCTAATGGATCTATCCGTTTTTATGACTTTCAATACAGAATTATAGCTTGGTTTGAA
GATGCAATTATAGGCTCTATCAGCAATATTTCTTTTGCAAATACTCCAATGATTGAAGAC
AATGAAGATGAAGATGGCTTTGATGATGAAAGAAAAGATAAGGGTGAAAATGAACCTAAA
TTTATCTGCCCTGACTTTATTGTAGTAGATCTTGATGCAACTATCACTATGTTAAATTAC
AAACTTTTTGAAGAATTAGATGATGAAAAGAAAAAGGGAACTACTTTAATGAAATCTATA
GTTTCACCAATTATTGCAATGAGTTGTAGACCAAACTCTAATGTTATTGGTATTTGTTGT
GAAAATGGTTATCTTTATGAATGGAATTTCTAAGAAAAATCTTCCGTTCTATCTATTTTA
AGAGTATTTGATACAGATAAAGAAAATATTCCTAATTGCATTGATTACTCTCCAGATGGA
AATTGGCTCTCTGTAGCCACTAAGTCTGGTAAAATCCATATATTCGATTGCAAAGAAAAA
TAATGGCAAAACTCAGTTCTTGAAGTATCTGAAAATGAATAAGGAAAACCCAAAGTTAAT
ATGCAGGTATTTTCTTCAGACTCAAAAAATCTAGCTACTATGGATGCTGATTATGCTGTT
TCACTCTTTACTATTGATCATAGATAATTTGATGTGAATATTCCAGAAAAGGAATGGTAA
TTCGTTGGAAAGCATAGAATCCATCATAGTGAAATTAAATCTATAGCATTTGGCGAGTCA
AAAAATGAAAACGATAAAAAATATTATAGATTATTTAGTATTGGAGCAGATATGAAAATG
GTAGAATATGAAGTTCTTGAAATCGACTATAGCAAGCAAAAAGAAAAAGGATAATAAATA
AATTATATTGACAGACTAAAGCTTAAATCCATATATCCAATTGAATAAGAAACAATACCT
ACTGCATGTATCTGGTACCCTATAAATATGTATAAAGAAGATGTCCTGCTTACAGTCAAT
GAAGAATTCAAAATAAAATTGTGGCAATTTATGAAGGACAATTTCAAATTTTGTAAAAAG
ACATGTCTTGGTCCAATTTATGGTGGCGCAATAAATAAATTACTAATTTTAAATTAAAAC
GATGCTTAAAATGATTATTAAGATAAATACCTTGCTTATTCAACTAAAGAAAAAGTAGTA
GGAATTATTAAGCTTCCTTTAGAAGGTAATCCTAATTAAACTATGGGTTTAATTGCTCAC
CCTGATAAAATTACTAGTATTAGTTGCTCTAATGATGGTAAACACTTCTTTTCATCAGGT
TCAGATGATTATTGTGTTAATGTATGGTCTGTCAATGTGTAGGCTTTAGAATAAATATTT
GCAACCAATCCAAATGAAGACCCATATCCAAAACTTCTTGAAGGTGGAGAAGATGGATAA
ACACATTAAGACTTAAAGAATTTCTTCTATTATTCTTAGATTAGAAGTAAGGATGAGCAT
ACAACAAAAGCAAGAAAGCTAGATGGTAAAGTGCCATTAATTGCCATTCCAGATATGATG
AGGTCTATGGGTTACTATCCTACTAATAAGGAAATAGAAAATATGTAAAACGAAATTAGA
TTCTCTAAATATCTTGATCCTGGCGAGTAGGTAGAAGAATTAGACTTAAACATGTTCTTG
AAATTATTCGTCAATCACAGACCTGTATAAGGTATTGGTAAATCAAAAATTGCTGAGTCA
CTTAATACTTTAACTAAAAGTTTGAGTGATTCTGCTAAGGAAATTGCTGAATAGGCTAAA
GGTTAATCTGTATAACCTAAAACATATAATATTGATGGCATTGGAGAGATTTCTTTATAA
GACTTAAAAAAAATATTAACCACTGAAGGAGAGCGTATGACTAATGAAGAATTTGATGAA
TGTCTCAAAATATTATGTGGTGAAAATGAAGACTAAATTCCTCAATAAATTAATGTAAAC
AATTTATGTGAAGATATTTTAGGTTTTGAAGATTTAGAAGGTGAAGAAAGAGATGATAAC
ATTGAAGATTAGTATGAAGATGAAGAAAATGAAGAATATGATTAAGATTGA


>TTHERM_01262850(protein)
MYQQEEYEVNNEGQEDVSKINALNLKWTLGFNFQLTDGVHNLTNEKRKEIFYPVAHTGVI
YDYENNTQRLLQGHCNRITATAYCKFSDIIVTADCGPDSMLVVWDASTGIPKKTIFEPHP
NGCQALDISQDGQFIVTLSKEANTDTDVQSLSLWEWNKDDEPCLITNEFDRRIKDYQYFV
RFNSDDNTEFATTGKTRIVFWRREGEQKGFNYYSPGNIPSLKVLTQTVFIPDNTQVVTGT
TDGHIIVWDISLIIEKVDTPKERRAIKLVDLMNKSKKPDGKKGSNSINILKIQDNYLVIG
SSNGSIRFYDFQYRIIAWFEDAIIGSISNISFANTPMIEDNEDEDGFDDERKDKGENEPK
FICPDFIVVDLDATITMLNYKLFEELDDEKKKGTTLMKSIVSPIIAMSCRPNSNVIGICC
ENGYLYEWNFQEKSSVLSILRVFDTDKENIPNCIDYSPDGNWLSVATKSGKIHIFDCKEK
QWQNSVLEVSENEQGKPKVNMQVFSSDSKNLATMDADYAVSLFTIDHRQFDVNIPEKEWQ
FVGKHRIHHSEIKSIAFGESKNENDKKYYRLFSIGADMKMVEYEVLEIDYSKQKEKGQQI
NYIDRLKLKSIYPIEQETIPTACIWYPINMYKEDVLLTVNEEFKIKLWQFMKDNFKFCKK
TCLGPIYGGAINKLLILNQNDAQNDYQDKYLAYSTKEKVVGIIKLPLEGNPNQTMGLIAH
PDKITSISCSNDGKHFFSSGSDDYCVNVWSVNVQALEQIFATNPNEDPYPKLLEGGEDGQ
THQDLKNFFYYSQIRSKDEHTTKARKLDGKVPLIAIPDMMRSMGYYPTNKEIENMQNEIR
FSKYLDPGEQVEELDLNMFLKLFVNHRPVQGIGKSKIAESLNTLTKSLSDSAKEIAEQAK
GQSVQPKTYNIDGIGEISLQDLKKILTTEGERMTNEEFDECLKILCGENEDQIPQQINVN
NLCEDILGFEDLEGEERDDNIEDQYEDEENEEYDQD


>TTHERM_01262850(gene)
ATGTATTAGTAAGAAGAATACGAAGTTAACAATGAAGGCTAAGAAGATGTTAGCAAGATA
AATGCATTAGTAATTTTAAAATTAAAATGAAAGGATAGGGAGTGTAGTTAATTGGGTTAA
AAATTTGAAAAATATAATATTAAAGTTGTAATCAAGCTCCATTAATAAATTAGATATCTC
GCTCTCTATTTTAATACCCTACTAAATTGAAATGCATTAACAAATAATAATTTCTCTTAT
ATAAAAAGAATTTGAAATGGACTTTAGGTTTTAATTTCTAGCTCACTGATGGCGTTCACA
ATTTAACAAATGAAAAAAGAAAAGTAATTTTGTTAATCAGATTTGAAATATAATTAAATA
AGTTTATAATAACTAACTACACACGAATTAAAAATTCATAATATGAATAAAGGAAATTTT
CTATCCTGTTGCGCACACTGGTGTTATATACGATTATGAAAACAATACATAAAGATTATT
ATAGGGTCATTGTAATAGAATTACAGCAACAGCATATTGCAAATTCTCAGATATAATTGT
TACTGCTGACTGGTGAATATTTATTTATAAAATTAAATTTTAATTTGATATGCTGTTAAG
CCTTAAACATAAATTAATTTAAATCATCTATAAAAAGCGGTCCAGATTCTATGTTAGTAG
TCTGGGATGCATCAACAGGTATTCCTAAAAAGACTATCTTTGAACCACATCCTAATGGTT
GTTAAGCTTTAGATGTAATAATTTTTATTAAAATTAATTATATAAAATATAATTAAAATT
CAGTTTTATTTAATATATTGTTTGTACTAATAAAATTATAATTAGATTTCTCAAGATGGA
CAATTCATCGTGACTCTTTCAAAAGAAGCTAATACAGATACTGATGTATAATCTCTTTCT
TTGTGGGAGTGGAATAAAGATGGTAAAAAATAGAAATATTTGTTTGTTTTACTCATTATG
TAAATGTTTCCTTTAAATATTAATAGATGAACCATGTTTGATTACCAATGAATTCGATAG
AAGAATTAAGGATTATTAATATTTCGTTAGATTCAATTCAGATGATAACACTGAATTTGC
AACAACTGGTAAGACAAGAATTGTTTTTTGGAGAAGAGAAGGAGAATAAAAAGGTTTTAA
CTATTATTCCCCTGGTAACATTCCATCTCTTAAGGTTCTCACTCAAACAGTATTTATACC
TGATAATACATAGGTAAATATGAAATATTATTAAAAGTCTTCATTACATTTTTGTTTATA
TTTAAAGGTTGTTACAGGAACAACTGATGGTCATATTATTGTATGGGATATTTCTCTTAT
CATAGAAAAAGTAGACACTCCAAAAGAAAGAAGAGCAATTAAATTGGTTGATCTTATGAA
TAAATCAAAAAAGCCTGATGGCAAAAAAGGATCAAATTCAATTAATATATTAAAAATTTA
AGATAACTATTTAGTTATTGGTTCATCTAATGGATCTATCCGTTTTTATGACTTTCAATA
CAGAATTATAGCTTGGTTTGAAGATGCAATTATAGGCTCTATCAGCAATATTTCTTTTGC
AAATACTCCAATGATTGAAGACAATGAAGATGAAGATGGCTTTGATGATGAAAGAAAAGT
ATGTTTTTATCTTATTTAATTGTTCATTTCATCATTAATTAATAATAAAAAAAGGATAAG
GGTGAAAATGAACCTAAATTTATCTGCCCTGACTTTATTGTAGTAGATCTTGATGCAACT
ATCACTATGTTAAATTACAAACTTTTTGAAGAATTAGATGATGAAAAGAAAAAGGGAACT
ACTTTAATGAAATCTATAGTTTCACCAATTATTGCAATGAGTTGTAGACCAAACTCTAAT
GTTATTGGTATTTGTTGTGAAAATGGTTATCTTTATGAATGGAATTTCTAAGAAAAATCT
TCCGTTCTATCTATTTTAAGAGTATTTGATACAGATAAAGAAAATATTCCTAATTGCATT
GATTACTCTCCAGATGGAAATTGGCTCTCTGTAGCCACTAAGTCTGGTAAAATCCATATA
TTCGATTGCAAAGAAAAATAATGGCAAAACTCAGTTCTTGAAGTATCTGAAAATGAATAA
GGTGATTAATAAATATTATTTTTTTTTTCAAGTAAAGCAAATTTAAAAGAAAATTTAAAA
AATATTTAGGAAAACCCAAAGTTAATATGCAGGTATTTTCTTCAGACTCAAAAAATCTAG
CTACTATGGATGCTGATTATGCTGTTTCACTCTTTACTATTGATCATAGATAATTTGATG
TGAATATTCCAGAAAAGGAATGGTAATTCGTTGGAAAGCATAGAATCCATCATAGTGAAA
TTAAATCTATAGCATTTGGCGAGTCAAAAAATGAAAACGATAAAAAATATTATAGATTAT
TTAGTATTGGAGCAGATATGAAAATGGTAGAATATGAAGTTCTTGAAATCGACTATAGCA
AGCAAAAAGAAAAAGGATAATAAATAAATTATATTGACAGACTAAAGCTTAAATCCATAT
ATCCAGTAATTAATTGATTACAATCATAAAGAATTATCATATACTTATTTATTTATATTT
TATTTATTAAAGATTGAATAAGAAACAATACCTACTGCATGTATCTGGTACCCTATAAAT
ATGTATAAAGAAGATGTCCTGCTTACAGTCAATGAAGAATTCAAAATAAAATTGTGGCAA
TTTATGAAGGACAATTTCAAATGTATTTTAAATAATATAAAAATTATTTTATTTAAAAAA
AAAAACAAATTCTTAAAAATTAGTTTGTAAAAAGACATGTCTTGGTCCAATTTATGGTGG
CGCAATAAATAAATTACTAATTTTAAATTAAAACGATGCTTAAAATGATTATTAAGATAA
ATACCTTGCTTATTCAACTAAAGAAAAAGTAGTAGGAATTATTAAGCTTCCTTTAGAAGG
TAATTTAGATATTTATCAATTATTTATTGATTTTTTATTTTTAATTAATCAAAGGTAATC
CTAATTAAACTATGGGTTTAATTGCTCACCCTGATAAAATTACTAGTATTAGTTGCTCTA
ATGATGGTAAACACTTCTTTTCATCAGGTTCAGATGATTATTGTGTTAATGTATGGTCTG
TCAATGTGTAGGCTTTAGAATAAATATTTGCAAGTACAATTAGTTGATTAAAAAAATTTT
GTTATTTTATTATTGCTAATAAAAATAGCCAATCCAAATGAAGACCCATATCCAAAACTT
CTTGAAGGTGGAGAAGATGGATAAACACATTAAGACTTAAAGAATTTCTTCTATTATTCT
TAGATTAGAAGTAAGGATGAGCATACAACAAAAGCAAGAAAGCTAGATGGTAAAGTGCCA
TTAATTGCCATTCCAGATATGATGAGGTCTATGGGTTACTATCCTACTAATAAGGAAATA
GAAAATATGTAAAACGAAATTAGATTCTCTAAATATCTTGATCCTGGCGAGTAGGTAGAA
GAATTAGACTTAAACATGTTCTTGAAGTGAGCACTTTTAAATATTTATTTAATTAAAATT
TAATAATTTTATTTATTTATTTACTTACTTAATATTTTATTAAAAAAGATTATTCGTCAA
TCACAGACCTGTATAAGGTATTGGTAAATCAAAAATTGCTGAGTCACTTAATACTTTAAC
TAAAAGTTTGAGTGATTCTGCTAAGGAAATTGCTGAATAGGCTAAAGGTTAATCTGTATA
ACCTAAAACATATAATATTGATGGCATTGGAGAGATTTCTTTATAAGACTTAAAAAAAAT
ATTAACCACTGAAGGAGAGCGTATGACTAATGAAGAATTTGATGGTAATTTATAATATTT
TAAATGAAATATTAAATAAAATTAAAAATAGAATGTCTCAAAATATTATGTGGTGAAAAT
GAAGACTAAATTCCTCAATAAATTAATGTAAACAATTTATGTGAAGATATTTTAGGTAAG
GAGCAATTCATTTTCATTTAAATTTTTTTTTAACTAAAATTTATTGATAAATAGGTTTTG
AAGATTTAGAAGGTGAAGAAAGAGATGATAACATTGAAGATTAGTATGAAGATGAAGAAA
ATGAAGAATATGATTAAGATTGA