Identifiers and Description

Gene Model Identifier

TTHERM_00820660

Standard Name

FAP206 (Flagellar Associated Protein 206)

Aliases

PreTt09652 | 139.m00128

Description

RS2-specific microtubule-docking factor; required for assembly of radial spoke RS2, dynein c, and normal ciliary motility; homolog of Chlamydomonas reinhardtii FAP206

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00820660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_339790
Tetrahymena borealisEI9_14492.19.997093137033517e-262hypothetical protein (636 aa)
OxytrichaContig1126.1.g1139.997093137033517e-262Domain of unknown function (DU
F3508)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25540426: Vasudevan KK, Song K, Alford LM, Sale WS, Dymek EE, Smith EF, Hennessey T, Joachimiak E, Urbanska P, Wloga D, Dentler W, Nicastro D, Gaertig J (2015) FAP206 is a microtubule-docking adapter for ciliary radial spoke 2 and dynein c. Molecular biology of the cell 26(4):696-710

Sequences

>TTHERM_00820660(coding)
ATGAATTAGCTAGAAGAAATAGTTAAATATGTTATTTATAAGTGCAGAGAAAACAATCAT
CCAGTAACTGAAACGCTTGCCGCTTTTGTTACCTAAACGATTTACAATCCAAAAACTGAC
AGATTCTACTTGGAAGATAAATTGACTGCCTCTCAAGTTGATGAACTCAAAGCAACTGTT
CTTTAAAAATTATCTCAAATAGATAAGCCAAACATGAAGACAATATAAATGCAAATATCT
TATGACAGTGCTTACATTGAATCAGAAATACAAAGATAGGAGAGAATAAAGAATTAAAGT
ATTGAAACTGGTAAGTTAACAGATGAAGTTGTTTCTCTTGAAATTAAAAATGCTAAAGAT
TTTGAAGGTCTCACCGTACTATTTAAGAAAATATTTAATTTTTTGCTTTACAAGAATAAA
GAACTTATGTATGATGGAACTAATAAAACTGGTAATTAGGACTCTGAAAACTAAGCAACT
TAATTTAACATTGAAAAGGAAGTTGCTGCAGGTCTTGAAAGTGTCATTCCAAGAGCAGCT
CTTGGACCTTTTGTTTCTCTAAATCCATCTGAAAAAGTGACTCAGTTAGTTGAATTATCT
AATTTGGTTATTGGTATTCGTCTTTTCAACAAATGGATCCAAAAAGGTGGTATTGGCTTA
GTTCCTTTCTAAGATTTACTTGAATATGAAGGAAGAGACTTAATTGAAAGAATTCGTTAA
GAGGCATTTGAAGTAATTGAAAATTGTGATAACTATACTATATTCTTTTAGAATGTTGGT
CCTGGAAAAATAAAAATAAGTGATGAACAATTTAAATAATATAAAGATGAATTAACATTT
TTAAGATAATATCTTTCATATATTCTTTCAATTTAAGAAGACGTAGATATATCTGAAAAT
AGCGTTGATTCTAATTAAACAAGATATCTAAAAGAAATTAAAGATCTTGAAACACTTTTA
AAGTAAAAGTCTTCAGCTCCTAAGGAGTAGGTCTATCCCAAATTTGCTACTTTGGCTCAA
GCTTATATTTAATTATTAGAAGAAAAGAAGCTTTGTTTAACAAGAGTTAAGTTATTCGAG
TTACTCCAAGAAATGAGAAAAGGATTTAAGTTGACCCTACCCAGAAACTTAATTCTCACT
GCAAAAAATATCAGCCAAGATCCATCTAATGAGGAATAAGTAGAAATTGAATATTCAGAA
GACTGTGGTATCGAGCGTCTTCTTCCTAAAAATACTCCTGATTTTATGCAAACTCCTCTT
GATTATTTAGGATTTTGCTTGTGGTCAATTGTAAAAAGAGATGGTTTATTGCTACCAGGT
AAACCTGCTTTAGGTGTATTTAGATATAAGGATAAGAATTGCGTTTTCTCTGATGAAAAG
AGCATAAATGAATTTTTAAGTGATCCTCAACAGTTTATTTAAGGTGTAATTAACTAATGC
AGAAAGAATCCAGAATTAATTCACTTACTTAGAATGGATGATTCATTTAAAAACGTTAAC
TTGAACATCTATGTGTCTGGTTAAGAAGGAGGACACTAACTTTCTAATAAATTGATGGTA
GATAAAGGTATTGAAACTCCTCTTCACTTTGTTGAAAAGAGACTTGACCCTAACTACTGC
TGGAACGAATGGGAACTCAGAAAAAAAGCTTTACAAATGGCTAATATTAGAAAAAGATAA
ACCAAAGCCTGCCAAACTATATTATCAAACTTTAAGGTAGATTCAGAAGCTCAAACCTAT
CTCCCCAAAGATAACGAAACAAATACTGGTAAAACAGAGTGGGACATAAGAAAATTCGCA
ATAGAGCAAGCCAAGAAAAAGGGTATAATTGCTGGTACAGATAGAGCTCCATATCCTATT
CATCCTAGAAACTACATAACTGGATTAAGAGACAAAGACACTAATTGA


>TTHERM_00820660(protein)
MNQLEEIVKYVIYKCRENNHPVTETLAAFVTQTIYNPKTDRFYLEDKLTASQVDELKATV
LQKLSQIDKPNMKTIQMQISYDSAYIESEIQRQERIKNQSIETGKLTDEVVSLEIKNAKD
FEGLTVLFKKIFNFLLYKNKELMYDGTNKTGNQDSENQATQFNIEKEVAAGLESVIPRAA
LGPFVSLNPSEKVTQLVELSNLVIGIRLFNKWIQKGGIGLVPFQDLLEYEGRDLIERIRQ
EAFEVIENCDNYTIFFQNVGPGKIKISDEQFKQYKDELTFLRQYLSYILSIQEDVDISEN
SVDSNQTRYLKEIKDLETLLKQKSSAPKEQVYPKFATLAQAYIQLLEEKKLCLTRVKLFE
LLQEMRKGFKLTLPRNLILTAKNISQDPSNEEQVEIEYSEDCGIERLLPKNTPDFMQTPL
DYLGFCLWSIVKRDGLLLPGKPALGVFRYKDKNCVFSDEKSINEFLSDPQQFIQGVINQC
RKNPELIHLLRMDDSFKNVNLNIYVSGQEGGHQLSNKLMVDKGIETPLHFVEKRLDPNYC
WNEWELRKKALQMANIRKRQTKACQTILSNFKVDSEAQTYLPKDNETNTGKTEWDIRKFA
IEQAKKKGIIAGTDRAPYPIHPRNYITGLRDKDTN


>TTHERM_00820660(gene)
ATGAATTAGCTAGAAGAAATAGTTAAATATGTTATTTATAAGTGCAGAGAAAACAATCAT
CCAGTAACTGAAACGCTTGCCGCTTTTGTTACCTAAACGATTTACAATCCAAGTAAAGTA
TTGAATAGAATAGATAATAGATTGATTTTAGTTTCATAAATGATTATAATCATCAATCAT
ATTTACTGAAAAAATAAAAAATATTTTTTAAATCAAGAAACTGACAGATTCTACTTGGAA
GATAAATTGACTGCCTCTCAAGTTGATGAACTCAAAGCAACTGTTCTTTAAAAATTATCT
CAAATAGATAAGCCAAACATGAAGACAATATAAATGCAAATATGTAATAAATTTATCAAT
TAATGCTATTAGCATCAAAAATAATAGTTTTGACTACAATCATAGTAAAATGAGTGATAA
CAATAAAGCTATTAAATGAATGCGAATATTATTTTAATTTAGATGGATTATTAAATAGTT
TTTATTTGAAATATAGCTTATGACAGTGCTTACATTGAATCAGAAATACAAAGATAGGAG
AGAATAAAGAATTAAAGTATTGAAACTGGTAAGTTAACAGATGAAGTTGTTTCTCTTGAA
ATTAAAAATGCTAAAGATTTTGAAGGTCTCACCGTACTATTTAAGAAAATATTTAATTTT
TTGCTTTACAAGAATAAAGAACTTATGTATGATGGAACTAATAAAACTGGTAATTAGGAC
TCTGAAAACTAAGCAACTTAATTTAACATTGAAAAGGAAGTTGCTGCAGGTCTTGAAAGT
GTCATTCCAAGAGCAGCTCTTGGACCTTTTGTTTCTCTAAATCCATCTGAAAAAGTGACT
CAGTTAGTTGAATTATCTAATTTGGTTATTGGTATTCGTCTTTTCAACAAATGGATCCAA
AAAGGTAAAACTCAAATAATAAATAAATTGAATGGAATTTATTTATTTGTTAAACAAAAT
AATCAAGCAAACAAACAAGCAAATAAATAAATAAATTTTTCAAAAAGATATTCAAGAGTA
AAATGAAATTTAAAAAAAATAAAAATGCAAATTTAAATTTTAAAGATTTTTATTTTTGTT
TGAAGCCAAACAAATATTTAAAATGAATGCAAATAAATAAAAAGGATTAATTTATTGGGC
AAAAAAGAGGGAATTTAACAAATTGAATAATATTTAGAAAATAAAAAATGAAATTGATTA
TTTTGTAATTAAAAAGGTGGTATTGGCTTAGTTCCTTTCTAAGATTTACTTGAATATGAA
GGAAGAGACTTAATTGAAAGAATTCGTTAAGAGGCATTTGAAGTAATTGAAAATTGTGAT
AACTATACTATATTCTTTTAGAATGTTGGTCCTGGAAAAATAAAAATAAGTGATGAACAA
TTTAAATAATATAAAGATGAATTAACATTTTTAAGATAATATCTTTCATATATTCTTTCA
ATTTAAGAAGACGTAGATATATCTGAAAATAGCGTTGATTCTAATTAAACAAGATATCTA
AAAGAAATTAAAGATCTTGAAACACTTTTAAAGTAAAAGTCTTCAGCTCCTAAGGAGTAG
GTATCAATAATATAAACCATATATATTGATCGAGAGATGTATTTTAAATTTTAAAATATA
GGTCTATCCCAAATTTGCTACTTTGGCTCAAGCTTATATTTAATTATTAGAAGAAAAGAA
GCTTTGTTTAACAAGAGTTAAGTTATTCGAGTTACTCCAAGAAATGAGAAAAGGATTTAA
GTTGACCCTACCCAGAAACTTAATTCTCACTGCAAAAAATATCAGCCAAGATCCATCTAA
TGAGGAATAAGTAGAAATTGAATATTCAGAAGACTGTGGTATCGAGCGTCTTCTTCCTAA
AAATACTCCTGATTTTATGCAAACTCCTCTTGATTATTTAGGATTTTGCTTGTGGTCAAT
TGTAAAAAGAGATGGTTTATTGCTACCAGGTAAACCTGCTTTAGGTGTATTTAGGTAAAA
ATAAATATTTCAACTCAATTAAAAAAATCAAATTATTTTAGATTGAAATTTAATTAAATT
TTTTTTTTAATTTTAATTACAAATAAACATTTAAATTTATTTTAAGAATTTTTGAATTAT
TTAGAAATTTTTGTTTAATTTAATAAAACAATAAAATAAATAAAATTCTAAAATAAAACT
CAAAAAAATTGTTACTTAATTTGCTGATAAAAAATTTTAGTAATGGCAAAATAAATAAAA
AATATTCTTAAATTTATTAGATAATAATTAAAATTTGCTTTTTTTTGAATTATAATGATA
ATTTTTGTGCTTAAATAATATTCAATTTAAACTAGAAAATTGAATGCTAAATTAAAATAA
TAAAAATAATTGCTTATGTGTTTTAAGCAGAAGATAGATCTAATATGTGTTTAAAATCAA
AGTTATAAATTAATTATGAGATATTTTTACATTTATTTGGAACAAAAATTTATTTTAAAA
ATATTTAGATATAAGGATAAGAATTGCGTTTTCTCTGATGAAAAGAGCATAAATGAATTT
TTAAGTGATCCTCAACAGTTTATTTAAGGTGTAATTAACTAATGCAGAAAGAATCCAGAA
TTAATTCACTTACTTAGAATGGATGATTCATTTAAAAACGTTAACTTGAACATCTATGTG
TCTGGTTAAGAAGGAGGACACTAACTTTCTAATAAATTGATGGTAGATAAAGGTATTGAA
ACTCCTCTTCACTTTGTTGAAAAGAGACTTGACCCTAACTACTGCTGGAACGAATGGGAA
CTCAGAAAAAAAGCTTTACAAATGGCTAATATTAGAAAAAGATAAACCAAAGCCTGCCAA
ACTATATTATCAAACTTTAAGGTAGATTCAGAAGCTCAAACCTATCTCCCCAAAGATAAC
GAAACAAATACTGGTAAAACAGAGTGGGACATAAGAAAATTCGCAATAGAGCAAGCCAAG
AAAAAGGGTATAATTGCTGGTACAGATAGAGCTCCATATCCTATTCATCCTAGAAACTAC
ATAACTGGATTAAGAGACAAAGACACTAATTGA