Identifiers and Description

Gene Model Identifier

TTHERM_00459450

Standard Name

FAND1 (putative homolog to FAND1)

Aliases

PreTt20376 | 53.m00278 | 3712.m00136

Description

Viral A-type inclusion protein repeat containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF07620 ) SLEI
  • ( PF00992 ) Troponin
  • ( PF02524 ) KID repeat
  • ( PF02845 ) CUE domain
  • ( PF00261 ) Tropomyosin
  • ( PF01576 ) Myosin tail
  • ( PF07813 ) LTXXQ motif
  • ( PF08663 ) HalX domain
  • ( PF09311 ) Rab5 binding
  • ( PF02370 ) M protein repeat
  • ( PF04012 ) PspA/IM30 family
  • ( PF06008 ) Laminin Domain I
  • ( PF00904 ) Involucrin repeat
  • ( PF01920 ) Prefoldin subunit
  • ( TIGR01612 ) rhoptry protein
  • ( PF04778 ) LMP repeated region
  • ( PF07709 ) Seven Residue Repeat
  • ( PF00444 ) ribosomal protein L36
  • ( PF00170 ) bZIP transcription factor
  • ( PF04702 ) Vicilin N terminal region
  • ( PF00769 ) Ezrin/radixin/moesin family
  • ( PF08614 ) Autophagy protein 16 (ATG16)
  • ( PF00038 ) Intermediate filament protein
  • ( TIGR00020 ) peptide chain release factor 2
  • ( TIGR01725 ) phage protein, HK97 gp10 family
  • ( PF02183 ) Homeobox associated leucine zipper
  • ( TIGR01216 ) ATP synthase F1, epsilon subunit
  • ( PF04394 ) Protein of unknown function, DUF536
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF04325 ) Protein of unknown function (DUF465)
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( PF01814 ) Hemerythrin HHE cation binding domain
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( TIGR00741 ) ribosomal subunit interface protein
  • ( PF07122 ) Variable length PCR target protein
  • ( PF04728 ) Repeated sequence found in lipoprotein
  • ( TIGR02449 ) conserved hypothetical protein TIGR02449
  • ( PF01052 ) Surface presentation of antigens (SPOA)
  • ( TIGR01560 ) uncharacterized phage protein (possible DNA

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00459450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13836.19.997093137033517e-262hypothetical protein (1716 aa)
OxytrichaContig11784.0.g110.000009002574193719714Reovirus sigma C capsid protei
n

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00459450(coding)
ATGAATAAGCAAAGTTTGGGAAAGTTAGAAACATTAATGAAGGAGGTGGAGCAAAAAAAC
CACTAAATTCATAAAAATATAGAATCATCAGAGTAATCATAAAGAGAATAGAGGATCATA
GATTAATAAGCAACTGCATATAACCTTCCTAGATCTAGTTATACTTCTTAGTCGCCTGAA
AAGAGGAATTTTTAATAATCAGATTAGAAGAATAGAATATAAACTTTTGGATAAACTAGC
AGTTATAGTAATTTAAAAAGCAAAATAGGATTCAGCAATGATTCTGCAAAAAATCCATAT
ATTTAAGGAAGCCACTCTTCTTCTGTGGAACGCAAAAAGATTTCATTTACTCCTAGTAAA
GATTAAATGACATTAACAAATTAGAATTAATAGCAGTAGAGTTCTATTGTTTAAGTTGTT
TAAACTTAAAATAGCAGTAGGATACCAAAACTACCTATTTCAGTAAGCGGAAATGGAGCA
AATTCTATTTCATAAACTATTCCTATAGTTGTTTAAGCAAGATCAAGAAGTAGAGATAAC
AATTAATAAACTCAAACAGCAGAGCCTAAAGTTCATGAAAGATAAAATCAATTAGAAATA
GAAAGTACTCCACTTTAAGCTAATACTAGAAATCATGAAAGAAAGCACTAGCAATAGCGT
ATAGCCCCTTCATAAGAATAGCAAACGAGTTTGGAAGTGATGAAATAGGAGCATGAGTTA
TTAGAGAAGAAATACTCTAAGAAATAAAATTAAGTGAAGGAGTTAATTGTTTTAGTAACT
CAGAAGGAGAAAGAAATTAAATAATTAAAGAGTTAATAATAGAGTATTTAGCAAAATAAA
AATTAATTAATTTCTGGCAATGATGAAAAATAAAATTAAAATCATGCTTTTGGAAATTGT
GTTTTGAATGATCAAAAATTGTTTGATTATTGCTTATTTTTAGAAGGATAATATCGCAGA
CTTGAGAGGAAAGTAAAGAGAAAGTCTAGAGAGATAGAAATACTTAGAAAAGAAGTTAAA
CCTGCTGTATATCAAAAAATTCATCAGGAAATTTAAAATATGAAATTTGAAGAGTGTGAA
GAAGATTATAAATGGTTAATATAATTTTATAATGGCAGGAATATACCAACACTTAGCTAA
AATAATATTTCATCTTCAAAAGAACTCTATACCTTAAGCAAGCAAATGATGCAAGAGCAA
TCTGAGAATTTTAAGGAACTTAGAAAAAAGCTAAAAGAACAAGAAAAGATAATAAATAAG
GAATAAGAAATCATTGTGAAGGAAATGGAAAGAAATCTTAAAAATTCTAAGGATGAGCAA
AAGAAATATTAGATTTAATATGAAAACAAGAAGAAAGAGATTATTTAAATCAAGTAGAGC
TTAACTATTTAAATCAACACTTTATCTCAATAAGTTGATTCTCTTAAAAGTGAAAATAGT
TTACTCAAGCAAGAGATATAAAATATAAACATCAATCGCTAAGCTGAGTTAAATGAATTT
GAAGAAGTCAAATTGTAACTAGAAAATGCTGAGCATTAATTATTTTAAATTCAAAGAGAG
TACTAAACCAAGATTGAGGAAGTCAGCGAAAAAAAGTATGAAAACAGCTAAAATCATATT
ACAGTTTCTCAACTAAATGACCAAATCAATAGATTAAATCAAGAAAATGCAAATCTTCTT
AAAGAGAAAGAATAAGTATTACGTAAATCTGAATCTGACAAAATGCGTATAGAAGAATTC
TAATTAAAGCTTTCAAAGGTAAATGAGGTTTAGGAATAATATTAGTTAGAAATAAGATAG
CTTTCAGTAAAGTTAGCAGATAAGGAAAATGAGATTTATGAAAAAATGCAAGAAATAGAC
TAGCTAAGATAGATTAGTAGTAATGATTTGGAGATTTAGTAGTTAAAAGAAGAAAATTAG
AATTTAATTGATTAGATTAACTAATTACATGAAGCACAATAAACATTGGCCATACATAAT
GTGTAAATCAATGACGAGTTACGCAGATTGCAATAGTAGAGCTCAGTTAATGTCTAGTAA
ATAATTATTGAAAAGACTTAGATTTAAGAAAGGTATACATACATCTTGAAAGAAATAGAA
GAAAAAAATATCATCATCCATCAATATGAAGAGAAAGAAGATCAATATCAAGCAGAGGTT
ATGAATTTTACTAAGTAGTTGGAGAATCTTTAAGAGAAATATGATAGAATGAATGAAGAA
TTCGATGATTTATTGAATGAAAAAGAATAATTTTTAATTTAAATTTAAGATTTATAAAAT
AAATGCTAACATGAATAAGAGATAAATTAAAAATACTTAGATCAAATAGGAAAATACAAG
CAAGATGATATTGATTAGTAAAATAGAGAGAAAAAGTACCTTAAAGAAATATAAAAACTC
AAAGATGACATCGATTAGCTGTCAAAGTAAAGCAAGAAAAATTAACATGAAAATAATGAA
GAAATCAAAGCTATGTTGACTTCTTTGCAAACTAAAAATGAGAAACTGGAATAAGAAAAT
GCATAAATATTGTAAAGTAGTTAAGAATAACAAAATTAATTGTTAACTAATTTAGAGATG
CTTACTTAGCAAAATATTGACGTATAAAATAATTTGGCTATTTTAGAAGAAGAAGTCAAT
TAAAAGGACTTGAAAATACAGCAATTAGAATAAGAATTGCAGCTATCTGCTTAAAAAATT
GAAACATTTTTGAGTCTGTAGCAATAATATTTAGCTGAAGAGGAAAACAAAATAAAGCAT
GCATAGAACTAAGCCTTATTAAAACAGTAAGAATAGAAACTGGAAATAATAATCGATGAT
TTGAAGAACAAGATAGATAAGCTAAATTAACAAATTAAAGATCAATAGTATGAAAATAAG
GAGGTGAAATTTGAATTAGAAAAATGCAGAGAAAGTAAAAAAGAATAAGAAGAAAAACTG
TAAAAGTAAAAAGATAAAAATAAAGAACTTAAATAAAAAATTACAGAAATTGAAGCATTA
AGTGTCAAATAAATTTCATAGTTATAGTAACAAATTTCATAATATGAAATCTAAATCAAA
AATTCGCAGAAGGTTGAACAAGACTTAAAAGATAAAATCACAGAAATAAAAGAAAAACTC
TCTTAAAATCAATTAGAGCTTAGTAAACAAAAAGAAAAAAGTAGTAGTAGCAGCAGTAGT
AAAAATGTTCTAAGAAGTGAATACATTTAAGAAATTGAAAAATATTAAAATCAAATTAAA
GAATTGAAAAACAACCTTGATGACAAAGAAAGAGAAACAAGAAAAATATTAACTGAATAT
AATGAGGCCAGGAATAAGATACTCTCTTATCAAACAGAATAACTCGAAAATGAGGAGAAA
ATAGACAAGTTAAAAGAAGAACTCAAAGTTAAATCTAATAAATTAAATTAGTAATAAGAA
ACTATAGACTAGCTCCAATAAGAAATCTAGAAGAAATAAAACATCATCATGAGTGGCTCA
AATAATCTGAATAACAGTTAAATAAGCTAAATCAATGGAAATAGCAATCAAAGAAGATCA
CTCAATAACATTATTGTAGATGAGAGTGGAATAAATAATACAAATCATGTCTCTTAACTG
AACCAATAAATTAATGATCTTTAAAATTTATTACAAGAGAGAGAAAATATAATTAACAAT
TTAAAAGAAGAAAATAAATAGATTTAAGACTTCTATCATTCAGAATAGCAAGAAAAGGTC
AATCAACTAGAAAATTAGTACTAATAAATTGAAAATCAAATTAAAGAGAGGGATGATAAG
ATTGCCTACCAATCCTCTCAACTTGATCAAAAGTCAAAAGAAATTCAACAACTTAATGAT
AGGATAAAGTAAATTACTTCAACAAAAGACCAAATTACTTAATAATACAGCAAGCTTTAA
GAAAATAACTTGAAGTTACATGACTAAAACGTTGAGTTAACTGCTAAGCTAGAAAACTTC
TAACAAGAGTTTTAAAAAATAATTGTTAAAGTTAAGGAATAAGAATAAGCAACCAATTAT
AAAGATATGATCATTCAGTAATTAGATGATAAAATAAAAGAATTGGAATAGGAAAAGCAA
GAGGCTGATAAGGTTATAGACAAAGTAAAATCAAGCAAAAAGGACTAATTGAATGATGCC
TAATAACAATAAAAGAATTTATAAGCTAATAATGAGTAAAAATAAGCTTTGATTGACTAA
CTCAGCGCAAAAGTTGGTAAATAATAGAAATAGGTTGAGGATTTAGAAGTTTAATTATCA
GAGACTTAAACTAAAATAAAATAATTATAAGATCAAGTTAATGATTTGGAAGAGTAAAAG
TAAAACAAAAATGAAAAATTGCAAGAAAAGGAAAAGGAATTATTTGCTGTTCTATCTAAA
TCTAATGAAAAAGAGTAAAATTTAGAAAATTAGTTAGAAGATGTTCGTAGGAAATTGAAA
GAAGTAGAAGATAACTTGCAAAAAGCTCTTAATACCATAGAATAAAAGGAAACTGAACTA
AAGCTAATTAAAGAGAGGTTAACTAAATCAGAAAAATCTGAAAAGAAACTAGAAAAAGAA
AGAAATTAAAAGAGTGAAGAAGTTTAATAGCAATAAAAAGATGTAGAATAATTGTAATAG
AGAGTTTAAATTTTAGAATAATAAAATTCAGAATATGGAAAGATTATTTAAGGAAAAAGT
AATGATTATGATTCAATAATAAAGAGTGTTCATAAAGAACTAAATACATAAATAGAAATT
GTTTAAACCCATAAAACACTCTTAGATAAAGAGTAAAGCGAGCATGAATAAACTAAGAAA
GAATTCGAAGATTGGAAGAATAAGCTATAAAAAAGTTAAGAAGAGAATAGATTGAAAACA
GAAGAGATTTAAAATATCTAAGACTAGCTTATAGATACACAAAATGAAATAAATTCTTAA
GAGGAAACAATAAAAAATCTAAATAATTAATATGAAAATTTATAAAAATAGAATGAATAA
TTAAATGAGGAACACAATAATTTAAAATCTAAATTGACTTCTTTGAACGAAGAATATTCA
TTTAAGATAATAAGAATGGAAGAAACAATTAAAACACTTGAAGAAGAATTGAATTAGCTT
AAATAAAATAATTATGACTTATAATAATTGATTTAAGAGAAAGATAATCTTATTCAAATA
AACATTACTAAAATTAATTAATATGAGTAATAAATTATCAATTTCTAAGAAATTATTTAA
GACTAGCAAGATCAAGCTTAAATTTAAAAGCAATAAATAGAGTTGCAGGCATAAACATAG
GAAAGCACTTTAAAAAAGCAGAATGAATAAGTTATCGCTCAAATTAGAGCTGAATTAGTT
AAAGAAAATCTTTAAAATATCTAAAATTGTAAAGAAGAAACAGAAATCCATTTCCAAAAT
ATCTTGCAAGAAAAAGAATAATAATATCAAGTCTTATTCTAGCAAACCACTTAATCATAC
GAATCTAAAATTATCTTAATATAACAAGAATTCTAAGTAATATTACAATAAAAATTAGAA
GAGCTTGAGGCTGCTTAAAGTGCTATCTTGTAATAAAAGCTAAATGAGCAAGAAGCACAA
CATTAGAAGGAATTGTAAAAGCTATTGAAAAATTAATAAAACGAACTACAAAGTAAATTT
TAAGAAGAAATGAAACATTTAGAAGCACAGTATTAAGAAAAATTGAATGAGTAGAGTGAG
AACCATAACAAAATATTGAGTGAACAAGCTAAGTAAATTTAAAATAGTGAAAATCAAAAC
TTGTCATAAAAGATTATCGATTAATAGACTTAATTTGAATAAATTTTATCACAAAAATTA
AAAGAATCTGAAGAAATTCATAATTAAATTTTATAAGAAAAAATAAAGGAGTGTGAAGGC
AATTTCTAGCTTATTCTTTAAGAAAAAACAATAGAAATTTAAAATGAATAAAATAAGGTT
TTATTAGATAAACTCAAAGAGCAGGAAAGCCAACTCAATAAATAAATTCAATAAAAGCTT
AGTGCAGATTTTTAATAATAAGTATAAACTTTAGTTGAAAAATAAAAGCAATAAGAAGAG
AATTACAATAAAATAATTTAAGAAAAGGATTAATAAATTGCAAAAATGGATGAAATTTTG
AAAGTTAATTCTTAAGAATTCTAGCAGGTCTTATAAGAAAAAGAGGCATAGATATTAGAA
ATTACAAATAATATTAATATCATTTAATAATAAAATAATATATAAATTTAACAAATTAAT
TAATAGCACAAGTAGGAAATAAATGAGATAGTATCCTCTAAAAATGAAATTACAAAATAT
ACTAAGTCTTTAGAAGACTAAATTGCTGAATAGGAAATGAAGAATAAAGATAGAGATTAA
GAAGAAAATCAATTAAAATAAGAGTTGAAAAAGCAAGAAGATAAAGTCCATGATTTAACT
TAGAAGTATTCAAAATTATAAACAGAACTAGAAAATTTAAAAGAATAACACTAAGATTAC
GTTAAGCAGTTATAGAATTAGCACCTATAAGCTATTCAAGCCAAGGATTCTGATATAGAA
AAATTAAATGAAAATGTAAGAAATTCCAAAAAGAACTCACAAGACTTGCAGCTTCAATTA
TAGTCCTTGCAATAAACTAGGCACAACCTTGAAGAATAATTAAATGAATTAAGAACATTA
AATAGCAAATCAGCTAATTAATAAAGTTAATAATTCTCTTAATTACAAGATGAATACAGC
GAGCTGCAATAAAACCTTTAACAAAAGAATCTTCAATTTAAATAAATGCTTAATGAGCAT
GAAAGCGAAAAGAGTTAATTGAATGAAAAAATAACTAAAATTGAGAAATAATTGAAGGAT
AATTAAACTATTTGCTAAGAACATTAAAACTTAATAGAATAAAACAATTTAAAAATAAAA
GAGTAGCAATAAAAAATTAAAGAGTATGAAAACTAAATTAGCTAAATGCAGCAATAAAAT
GAAGAATAAGCTAAAATACAATAAAAAGAATAAAATAATTTAGATAAAGAAATAGAAAAA
TTGAAAAAGCATATTGAAAGCAATCAAAAGGAAGCTGCTGAATAGCAATAAGAACTAATT
AAGAAGCATCAGTAAGAAATTGATAACATTCAAAATTAAAATGATATTCATTTGTAATAA
CAATTAAATTAACTGAAATAATAATATGAGGTATAAATTTAATAGATTACTAAATAGTAA
AAAGAAGAGGCACAAAAACACAACTAATCAAGTGAATAACAAATTTAATAAATAACTGCT
AAATATTAACAAGATATTTAAAATATCGTTTAATAAAATGAATAAAAAATAGCTGAATTA
AATGAAGCCAATAAATAGTTAAGTTAAAAAGATTCAGATAACCAAATTAAAATACATTAG
CTTTAACAAGAATCTGAAAATAATTCAACAAATTTTGAAACTAAAATATCTGAAAATAGT
AAAATTTATGAAGAAAAAATAAGTTAAATTTCAATTACTTTTGAGACTAAAATAACTGAA
ATAAAATAATCATATGAAATATAAATAAATGAGCTGAAATAGCAATATGAGACAAAAATA
TAATCACTTTAAGAATCTGAAAAATAGACAAATGAATCAAGTAATAAAGAAAAGCAGGAA
TTAATTTCAAAATTAAAGGAAGAATTCTAAAAAGAAATAGCTGAAAAGGATGAAAATCAC
AATAAATAAGTTAAAGAAATTTAAGATAATTTAGATAAATAAATAAATGATTATGAATCT
AAAATTAAAGCTTTGCAAGTTGATTATCAAAAATAAATTGAAGAATCAAAAGCAGACCAT
GAAAAAAATATTAAAGAAATTACTGAAAAATTTGAAAAATAAATTTCTGACTTAAATGAA
AGATAATAGAAAGATATTGAAGGAATCTAAATTAACCACGAATTCATAATAAAAGAGTTA
TAAAAAAAGATTGAAACTCTAACAATAACTTTAGATGAAATCAACTAAGAAAAAGAAGAT
ATTGTGAACAAAGCAAAGGAAGAAGCTGAATAAGAGATATAGAATATCGATTAGAAGTAT
AGAAGTTAAATTTAGCAGATGCACAAAGATCATAATGATTATATCCTTAATACAGAAAGT
GATTAGTAAGATGCAATATAAACTGTTAAAGAACAATATGAGCTAGAGATTTAGGAACTC
AAGCAAATGATACCTTCAGATTCAAATGAATTAATATAAAAATATCTTAATTAGATCAAA
GAACTTGAAGAAAAAATATAATAGCTTTAATAATAAGATACTTAGTCAAATGAAGAAAAT
TAAAGATTAGAGTTAACAATTATCTAATTAGAAGAAAAAATAATTCAAGTTGAAAATAAG
TATCAAATACAACTATCCAACGAAAGTGAAAGTCACAAGCAATTAATAATTGAGATAGAA
ACTCAAAATAAAGAAAAAATTGCAGAGTTGTAAAGAATAGAAAATGAATTAAGAATTCAA
ATTGCTTCTCTTTTAGGTATGGATGAAAAACAAAAAGTTGATCAATAATAAAAAATAAAT
CAATAAGGTGCTGATAAAGAATAACAAATAGTAATCTTACAAAAAGAAATTCATACTATA
GAGTCAACTTACTAGCTTAGGATATAAGAATTTGAAAAATAAATTTAAGATATACAATTA
AGGGAATCTCAGAGATATAGTTAATTAGCTTAGAGATACTTATTAATTTGTCTTGAATCA
GAAAGATTAAAAAGCTCTGCAAATGAAAGAAACTCTTCTTCAGGCTCTAACACAAGTTAA
TATTAGAGTAGAATTAATGAATTAGAAATTCAAATTTAAAACCATATTGAAGTTATAAGT
AAGCTACAGTAAGAGCTTAATATAAGCAGTACTACTATTAATCAATAAATCTAAAAAATA
TAAATTTATGAATAGCAAATTTAATCAAATAATTTCACAGATTAAAATCTACTTTAAAAA
TATCTTATTGTTTGTTTGGAGGCAGAGAGACTTAGGTAAGTTGCATTAAATTAATCATCT
AAATCTATGGCTGTATCAAACTAACCTGTAGATTTTGATAAAGATTAGTAAATATCTAAA
CTATAAATATAAGTTTAATAATATGAACACAAAATGTCAGAACTACTCATAACAATAAAT
AGCAAATAAGAATTAATATCTAAATTAGAAACAGAAATCAATATTCATATAGAAAAGGTT
AGTATTCTTAATCAATAAATGCAATCATAATAAACTTAATCATCTGTTGACACTTAACTT
TTATAGAAATATCTTATAGTTTGCTTGGAAGCTGAAAGACTTAAGTTACAAAAAGGTACT
TCTGGTATCAGTATTTAATAAAACTTTAATGATTCAGAGATAGAAATTTTAAAGTAAAGA
GTTATTTAACTTGAACAAGAAGTTATCTACAAGTCTCAGATAATTAGTGAATTTGAAGAG
AGTAAAGGTGTGAAAAGGTCCACTAAGTCAAGTTAAAATTAGGAATTGAGCTAACAGTAT
TTAGTAGTCTGTATGGAAGCAGAGCGTCTCCAATAGTAATTATAAAAATAAAAAGCAGAT
TATGAGAATTAAATAAGCGAACTGATTAAAAAAGATAAAAGAAACTAAGAATACCTCAAA
ATAAATGATGCTCAAATTAAGGCCTTAAATGAGAAACTTAAATCCTCAAGCTAAAGCTCC
TTAAAATCAAATCCATCCTCTCCGGTAAATGAAGATTAAGATAATAAAATTAAAGAAATT
CAAGCTAAGTTAGAAAAAGCTCAAATGTAGATTGAGAGTTAAATGCAAAAAATAGAAAAA
CTTCACAATGAAAAAATAAATGTTGAGGATTCAAATGCTAACTTAAACAGATTTATAAAT
GATTTGAAGGATTAAAAGTCTTCAATAGAAAAATAACTACATTAATTGGAAAAAGAAAAT
ATTGAAAAATCTCATCAAATTGAAAAGCTAGAATAAGAAAAAATACTACTTCAAAAATCT
GTTGAAGAGTTAGGTGAGAAATTAATTAAAATGCAAATTTAGTAAAGAGATGAAGAGGAA
TATGATGACTAAGTATTCGTAGTAAATAGAAAAATGGATGCTTTAAAGAGTTTAGTAACT
CAATTAGAAAGAGATGTAAAGAAGTATGTTGAAACCTCTTAAACTATGTAAAGAATAGGT
ATTTCTTTATTCTCTGTCGATAGAGATTTACCTCTTGAAACCTTTGTAGAGCAACTAACA
TAAAATGTAAATGATGTTCTCAAATTCCTTGAACAATAAATAGATGATAAAGATGCTTAA
CTTGAAGATCTCCAAAGGAACTTGTAAGCAAAAGATGACTAGATCTACTAACTCTAAAAC
AATCTTGAAAGTCATCAGTAATCATTCTTACAAAAAGAATTCTAAACTGGAGAAGATAAA
AATATGGAAAAAGTTAATGAAATTTTAGGTCTTTCTGCTATTGGTGCAGATATTGTTGAA
TAGAAAAAAGACTAAAGTTTCCTTTCAGACCATGACATCGAAAACATTGCTATTGAAGAT
AAAAAAATTTCTGTATAGATTTCCTATAGAGACAATGATGAAATATAGGAAAGAAACTCA
AAGATGGGAGGTAGGCCATCATCTAATTAAGGATCAGTTTAGCATTCATATAATTAATAA
TCTTAAAACTAATCCTCAGTGCCAAATGTTGATAAAAATATAAAAGAATAATATGATCAT
TAAATATAATCATTAAACGAATAACATAGATCTATAAAGAGAAAATATGATAACTTATTA
ATAGAAAATGAAGACTTAAAAAGAAATCTTTCATCTTTCTATTCTTTGCAAGTAAATAAC
CCTCTTAATCCTGCTGAAATTAATTTGATGAGACAGGAAATGGATTAGTAAAAAATGCAG
CTTGACTAATTAAAGGAAGAAATTGAAGATCATGAAGAAAATGAAGAAAGGTATTAGCAA
CAGGTAATTCGTTAAATTAAATTGATTAATTTAAAAATTTTAATTTCTTTTTAAGTTTTT
AATGAAATTTTAATTTAATATATAAATTAATATAGATTGGATAATTAAAGAAGAAGATCT
TTGAATTAGAAAAGCAGCTCAAAGAAAGTGTAGCAGGTCATTAATATTAAGCTGTTAAGG
ATAGCTTTTAGAATTTCTTCAAACTTCATTTTGATAAAAACTCTAAAACTAACGAATTTA
TTAAAGCAGAAGAATATCTTAAGATCTTACTTAATTTACTAAATATCGGAGAATAATAAA
AGAAAGAGTGCGTCTTAGTTTATCAGTAAGTGGTGGCTAATTCTAAAAAATTCAAATTTT
TCTGAAATAACTACAGAAGCCATCATAAAAATTATATAGAAGTGTTATTTAATGCTGCTC
TATGTTAAAAAAAATTAAAAATTATATAATAAAATTTATTTAATTAAAAACTTTAGTCTT
GATAATTTATAATTTCATATAGTTAAAATACAAAAATATGTTTTTAATAATTCTAATAAA
TAAACTTTGAAATATATATTAATATCATGTTTATTACTTATTGTAAGGATGAAAAGTAGC
GCTCTTGTTTCAAATTTTTTTAAACAAATTTTAATGAACAACTAAAAGAAATTTACTTTT
AATAAAATTCAAAATCAATCCATTATTTATAATTTTTTTAACAAAAATACTACCTATCTT
TCATTATAATTTTATTAAACTTCATAAATTAAATTTAGTATAAAAAAATATAAAATTCTT
TTTTTAAATTGGTTATGA


>TTHERM_00459450(protein)
MNKQSLGKLETLMKEVEQKNHQIHKNIESSEQSQREQRIIDQQATAYNLPRSSYTSQSPE
KRNFQQSDQKNRIQTFGQTSSYSNLKSKIGFSNDSAKNPYIQGSHSSSVERKKISFTPSK
DQMTLTNQNQQQQSSIVQVVQTQNSSRIPKLPISVSGNGANSISQTIPIVVQARSRSRDN
NQQTQTAEPKVHERQNQLEIESTPLQANTRNHERKHQQQRIAPSQEQQTSLEVMKQEHEL
LEKKYSKKQNQVKELIVLVTQKEKEIKQLKSQQQSIQQNKNQLISGNDEKQNQNHAFGNC
VLNDQKLFDYCLFLEGQYRRLERKVKRKSREIEILRKEVKPAVYQKIHQEIQNMKFEECE
EDYKWLIQFYNGRNIPTLSQNNISSSKELYTLSKQMMQEQSENFKELRKKLKEQEKIINK
EQEIIVKEMERNLKNSKDEQKKYQIQYENKKKEIIQIKQSLTIQINTLSQQVDSLKSENS
LLKQEIQNININRQAELNEFEEVKLQLENAEHQLFQIQREYQTKIEEVSEKKYENSQNHI
TVSQLNDQINRLNQENANLLKEKEQVLRKSESDKMRIEEFQLKLSKVNEVQEQYQLEIRQ
LSVKLADKENEIYEKMQEIDQLRQISSNDLEIQQLKEENQNLIDQINQLHEAQQTLAIHN
VQINDELRRLQQQSSVNVQQIIIEKTQIQERYTYILKEIEEKNIIIHQYEEKEDQYQAEV
MNFTKQLENLQEKYDRMNEEFDDLLNEKEQFLIQIQDLQNKCQHEQEINQKYLDQIGKYK
QDDIDQQNREKKYLKEIQKLKDDIDQLSKQSKKNQHENNEEIKAMLTSLQTKNEKLEQEN
AQILQSSQEQQNQLLTNLEMLTQQNIDVQNNLAILEEEVNQKDLKIQQLEQELQLSAQKI
ETFLSLQQQYLAEEENKIKHAQNQALLKQQEQKLEIIIDDLKNKIDKLNQQIKDQQYENK
EVKFELEKCRESKKEQEEKLQKQKDKNKELKQKITEIEALSVKQISQLQQQISQYEIQIK
NSQKVEQDLKDKITEIKEKLSQNQLELSKQKEKSSSSSSSKNVLRSEYIQEIEKYQNQIK
ELKNNLDDKERETRKILTEYNEARNKILSYQTEQLENEEKIDKLKEELKVKSNKLNQQQE
TIDQLQQEIQKKQNIIMSGSNNLNNSQISQINGNSNQRRSLNNIIVDESGINNTNHVSQL
NQQINDLQNLLQERENIINNLKEENKQIQDFYHSEQQEKVNQLENQYQQIENQIKERDDK
IAYQSSQLDQKSKEIQQLNDRIKQITSTKDQITQQYSKLQENNLKLHDQNVELTAKLENF
QQEFQKIIVKVKEQEQATNYKDMIIQQLDDKIKELEQEKQEADKVIDKVKSSKKDQLNDA
QQQQKNLQANNEQKQALIDQLSAKVGKQQKQVEDLEVQLSETQTKIKQLQDQVNDLEEQK
QNKNEKLQEKEKELFAVLSKSNEKEQNLENQLEDVRRKLKEVEDNLQKALNTIEQKETEL
KLIKERLTKSEKSEKKLEKERNQKSEEVQQQQKDVEQLQQRVQILEQQNSEYGKIIQGKS
NDYDSIIKSVHKELNTQIEIVQTHKTLLDKEQSEHEQTKKEFEDWKNKLQKSQEENRLKT
EEIQNIQDQLIDTQNEINSQEETIKNLNNQYENLQKQNEQLNEEHNNLKSKLTSLNEEYS
FKIIRMEETIKTLEEELNQLKQNNYDLQQLIQEKDNLIQINITKINQYEQQIINFQEIIQ
DQQDQAQIQKQQIELQAQTQESTLKKQNEQVIAQIRAELVKENLQNIQNCKEETEIHFQN
ILQEKEQQYQVLFQQTTQSYESKIILIQQEFQVILQQKLEELEAAQSAILQQKLNEQEAQ
HQKELQKLLKNQQNELQSKFQEEMKHLEAQYQEKLNEQSENHNKILSEQAKQIQNSENQN
LSQKIIDQQTQFEQILSQKLKESEEIHNQILQEKIKECEGNFQLILQEKTIEIQNEQNKV
LLDKLKEQESQLNKQIQQKLSADFQQQVQTLVEKQKQQEENYNKIIQEKDQQIAKMDEIL
KVNSQEFQQVLQEKEAQILEITNNINIIQQQNNIQIQQINQQHKQEINEIVSSKNEITKY
TKSLEDQIAEQEMKNKDRDQEENQLKQELKKQEDKVHDLTQKYSKLQTELENLKEQHQDY
VKQLQNQHLQAIQAKDSDIEKLNENVRNSKKNSQDLQLQLQSLQQTRHNLEEQLNELRTL
NSKSANQQSQQFSQLQDEYSELQQNLQQKNLQFKQMLNEHESEKSQLNEKITKIEKQLKD
NQTICQEHQNLIEQNNLKIKEQQQKIKEYENQISQMQQQNEEQAKIQQKEQNNLDKEIEK
LKKHIESNQKEAAEQQQELIKKHQQEIDNIQNQNDIHLQQQLNQLKQQYEVQIQQITKQQ
KEEAQKHNQSSEQQIQQITAKYQQDIQNIVQQNEQKIAELNEANKQLSQKDSDNQIKIHQ
LQQESENNSTNFETKISENSKIYEEKISQISITFETKITEIKQSYEIQINELKQQYETKI
QSLQESEKQTNESSNKEKQELISKLKEEFQKEIAEKDENHNKQVKEIQDNLDKQINDYES
KIKALQVDYQKQIEESKADHEKNIKEITEKFEKQISDLNERQQKDIEGIQINHEFIIKEL
QKKIETLTITLDEINQEKEDIVNKAKEEAEQEIQNIDQKYRSQIQQMHKDHNDYILNTES
DQQDAIQTVKEQYELEIQELKQMIPSDSNELIQKYLNQIKELEEKIQQLQQQDTQSNEEN
QRLELTIIQLEEKIIQVENKYQIQLSNESESHKQLIIEIETQNKEKIAELQRIENELRIQ
IASLLGMDEKQKVDQQQKINQQGADKEQQIVILQKEIHTIESTYQLRIQEFEKQIQDIQL
RESQRYSQLAQRYLLICLESERLKSSANERNSSSGSNTSQYQSRINELEIQIQNHIEVIS
KLQQELNISSTTINQQIQKIQIYEQQIQSNNFTDQNLLQKYLIVCLEAERLRQVALNQSS
KSMAVSNQPVDFDKDQQISKLQIQVQQYEHKMSELLITINSKQELISKLETEINIHIEKV
SILNQQMQSQQTQSSVDTQLLQKYLIVCLEAERLKLQKGTSGISIQQNFNDSEIEILKQR
VIQLEQEVIYKSQIISEFEESKGVKRSTKSSQNQELSQQYLVVCMEAERLQQQLQKQKAD
YENQISELIKKDKRNQEYLKINDAQIKALNEKLKSSSQSSLKSNPSSPVNEDQDNKIKEI
QAKLEKAQMQIESQMQKIEKLHNEKINVEDSNANLNRFINDLKDQKSSIEKQLHQLEKEN
IEKSHQIEKLEQEKILLQKSVEELGEKLIKMQIQQRDEEEYDDQVFVVNRKMDALKSLVT
QLERDVKKYVETSQTMQRIGISLFSVDRDLPLETFVEQLTQNVNDVLKFLEQQIDDKDAQ
LEDLQRNLQAKDDQIYQLQNNLESHQQSFLQKEFQTGEDKNMEKVNEILGLSAIGADIVE
QKKDQSFLSDHDIENIAIEDKKISVQISYRDNDEIQERNSKMGGRPSSNQGSVQHSYNQQ
SQNQSSVPNVDKNIKEQYDHQIQSLNEQHRSIKRKYDNLLIENEDLKRNLSSFYSLQVNN
PLNPAEINLMRQEMDQQKMQLDQLKEEIEDHEENEERYQQQVIRQIKLINLKILISFQVF
NEILIQYINQYRLDNQRRRSLNQKSSSKKVQQVINIKLLRIAFRISSNFILIKTLKLTNL
LKQKNILRSYLIYQISENNKRKSASQFISKWWLILKNSNFSEITTEAIIKIIQKCYLMLL
YVKKNQKLYNKIYLIKNFSLDNLQFHIVKIQKYVFNNSNKQTLKYILISCLLLIVRMKSS
ALVSNFFKQILMNNQKKFTFNKIQNQSIIYNFFNKNTTYLSLQFYQTSQIKFSIKKYKIL
FLNWL


>TTHERM_00459450(gene)
ATGAATAAGCAAAGTTTGGGAAAGTTAGAAACATTAATGAAGGAGGTGGAGCAAAAAAAC
CACTAAATTCATAAAAATATAGAATCATCAGAGTAATCATAAAGAGAATAGAGGATCATA
GATTAATAAGCAACTGCATATAACCTTCCTAGATCTAGTTATACTTCTTAGTCGCCTGAA
AAGAGGAATTTTTAATAATCAGATTAGAAGAATAGAATATAAACTTTTGGATAAACTAGC
AGTTATAGTAATTTAAAAAGCAAAATAGGATTCAGCAATGATTCTGCAAAAAATCCATAT
ATTTAAGGAAGCCACTCTTCTTCTGTGGAACGCAAAAAGATTTCATTTACTCCTAGTAAA
GATTAAATGACATTAACAAATTAGAATTAATAGCAGTAGAGTTCTATTGTTTAAGTTGTT
TAAACTTAAAATAGCAGTAGGATACCAAAACTACCTATTTCAGTAAGCGGAAATGGAGCA
AATTCTATTTCATAAACTATTCCTATAGTTGTTTAAGCAAGATGTAAATTATAAATGTTT
TTAATTTAAATTTATCTAAAGATGTCCTGAAGTTTTTAATATTTTTAAACAAGCATATTT
TCATTGTTTTTTTTTCAGAATCATAATTTTTATTTTGAAAATGATAGCAAGAAGTAGAGA
TAACAATTAATAAACTCAAACAGCAGAGCCTAAAGTTCATGAAAGATAAAATCAATTAGA
AATAGAAAGTACTCCACTTTAAGCTAATACTAGAAATCATGAAAGAAAGCACTAGCAATA
GCGTATAGCCCCTTCATAAGAATAGCAAACGAGTTTGGAAGTGATGAAATAGGAGCATGA
GTTATTAGAGAAGAAATACTCTAAGAAATAAAATTAAGTGAAGGAGTTAATTGTTTTAGT
AACTCAGAAGGAGAAAGAAATTAAATAATTAAAGAGTTAATAATAGAGTATTTAGCAAAA
TAAAAATTAATTAATTTCTGGCAATGATGAAAAATAAAATTAAAATCATGCTTTTGGAAA
TTGTGTTTTGAATGATCAAAAATTGTTTGATTATTGCTTATTTTTAGAAGGATAATATCG
CAGACTTGAGAGGAAAGTAAAGAGAAAGTCTAGAGAGATAGAAATACTTAGAAAAGAAGT
TAAACCTGCTGTATATCAAAAAATTCATCAGGAAATTTAAAATATGAAATTTGAAGAGTG
TGAAGAAGATTATAAATGGTTAATATAATTTTATAATGGCAGGAATATACCAACACTTAG
CTAAAATAATATTTCATCTTCAAAAGAACTCTATACCTTAAGCAAGCAAATGATGCAAGA
GCAATCTGAGAATTTTAAGGAACTTAGAAAAAAGCTAAAAGAACAAGAAAAGATAATAAA
TAAGGAATAAGAAATCATTGTGAAGGAAATGGAAAGAAATCTTAAAAATTCTAAGGATGA
GCAAAAGAAATATTAGATTTAATATGAAAACAAGAAGAAAGAGATTATTTAAATCAAGTA
GAGCTTAACTATTTAAATCAACACTTTATCTCAATAAGTTGATTCTCTTAAAAGTGAAAA
TAGTTTACTCAAGCAAGAGATATAAAATATAAACATCAATCGCTAAGCTGAGTTAAATGA
ATTTGAAGAAGTCAAATTGTAACTAGAAAATGCTGAGCATTAATTATTTTAAATTCAAAG
AGAGTACTAAACCAAGATTGAGGAAGTCAGCGAAAAAAAGTATGAAAACAGCTAAAATCA
TATTACAGTTTCTCAACTAAATGACCAAATCAATAGATTAAATCAAGAAAATGCAAATCT
TCTTAAAGAGAAAGAATAAGTATTACGTAAATCTGAATCTGACAAAATGCGTATAGAAGA
ATTCTAATTAAAGCTTTCAAAGGTAAATGAGGTTTAGGAATAATATTAGTTAGAAATAAG
ATAGCTTTCAGTAAAGTTAGCAGATAAGGAAAATGAGATTTATGAAAAAATGCAAGAAAT
AGACTAGCTAAGATAGATTAGTAGTAATGATTTGGAGATTTAGTAGTTAAAAGAAGAAAA
TTAGAATTTAATTGATTAGATTAACTAATTACATGAAGCACAATAAACATTGGCCATACA
TAATGTGTAAATCAATGACGAGTTACGCAGATTGCAATAGTAGAGCTCAGTTAATGTCTA
GTAAATAATTATTGAAAAGACTTAGATTTAAGAAAGGTATACATACATCTTGAAAGAAAT
AGAAGAAAAAAATATCATCATCCATCAATATGAAGAGAAAGAAGATCAATATCAAGCAGA
GGTTATGAATTTTACTAAGTAGTTGGAGAATCTTTAAGAGAAATATGATAGAATGAATGA
AGAATTCGATGATTTATTGAATGAAAAAGAATAATTTTTAATTTAAATTTAAGATTTATA
AAATAAATGCTAACATGAATAAGAGATAAATTAAAAATACTTAGATCAAATAGGAAAATA
CAAGCAAGATGATATTGATTAGTAAAATAGAGAGAAAAAGTACCTTAAAGAAATATAAAA
ACTCAAAGATGACATCGATTAGCTGTCAAAGTAAAGCAAGAAAAATTAACATGAAAATAA
TGAAGAAATCAAAGCTATGTTGACTTCTTTGCAAACTAAAAATGAGAAACTGGAATAAGA
AAATGCATAAATATTGTAAAGTAGTTAAGAATAACAAAATTAATTGTTAACTAATTTAGA
GATGCTTACTTAGCAAAATATTGACGTATAAAATAATTTGGCTATTTTAGAAGAAGAAGT
CAATTAAAAGGACTTGAAAATACAGCAATTAGAATAAGAATTGCAGCTATCTGCTTAAAA
AATTGAAACATTTTTGAGTCTGTAGCAATAATATTTGTAATATTTTCAATTTTTATTTAT
TTTAAATGATTTTAATTAAATATTAATTTAGAGCTGAAGAGGAAAACAAAATAAAGCATG
CATAGAACTAAGCCTTATTAAAACAGTAAGAATAGAAACTGGAAATAATAATCGATGATT
TGAAGAACAAGATAGATAAGCTAAATTAACAAATTAAAGATCAATAGTATGAAAATAAGG
AGGTGAAATTTGAATTAGAAAAATGCAGAGAAAGTAAAAAAGAATAAGAAGAAAAACTGT
AAAAGTAAAAAGATAAAAATAAAGAACTTAAATAAAAAATTACAGAAATTGAAGCATTAA
GTGTCAAATAAATTTCATAGTTATAGTAACAAATTTCATAATATGAAATCTAAATCAAAA
ATTCGCAGAAGGTTGAACAAGACTTAAAAGATAAAATCACAGAAATAAAAGAAAAACTCT
CTTAAAATCAATTAGAGCTTAGTAAACAAAAAGAAAAAAGTAGTAGTAGCAGCAGTAGTA
AAAATGTTCTAAGAAGTGAATACATTTAAGAAATTGAAAAATATTAAAATCAAATTAAAG
AATTGAAAAACAACCTTGATGACAAAGAAAGAGAAACAAGAAAAATATTAACTGAATATA
ATGAGGCCAGGAATAAGATACTCTCTTATCAAACAGAATAACTCGAAAATGAGGAGAAAA
TAGACAAGTTAAAAGAAGAACTCAAAGTTAAATCTAATAAATTAAATTAGTAATAAGAAA
CTATAGACTAGCTCCAATAAGAAATCTAGAAGAAATAAAACATCATCATGAGTGGCTCAA
ATAATCTGAATAACAGTTAAATAAGCTAAATCAATGGAAATAGCAATCAAAGAAGATCAC
TCAATAACATTATTGTAGATGAGAGTGGAATAAATAATACAAATCATGTCTCTTAACTGA
ACCAATAAATTAATGATCTTTAAAATTTATTACAAGAGAGAGAAAATATAATTAACAATT
TAAAAGAAGAAAATAAATAGATTTAAGACTTCTATCATTCAGAATAGCAAGAAAAGGTCA
ATCAACTAGAAAATTAGTACTAATAAATTGAAAATCAAATTAAAGAGAGGGATGATAAGA
TTGCCTACCAATCCTCTCAACTTGATCAAAAGTCAAAAGAAATTCAACAACTTAATGATA
GGATAAAGTAAATTACTTCAACAAAAGACCAAATTACTTAATAATACAGCAAGCTTTAAG
AAAATAACTTGAAGTTACATGACTAAAACGTTGAGTTAACTGCTAAGCTAGAAAACTTCT
AACAAGAGTTTTAAAAAATAATTGTTAAAGTAATTTTTAATTATTTTATTAAAATATTAT
TTATTACTATCGTTTATTTTGCTAAAATTCTAATTGAAAGAGTTAAATTTATAATTTTAT
TAAAACATTAGGTTAAGGAATAAGAATAAGCAACCAATTATAAAGATATGATCATTCAGT
AATTAGATGATAAAATAAAAGAATTGGAATAGGAAAAGCAAGAGGCTGATAAGGTTATAG
ACAAAGTAAAATCAAGCAAAAAGGACTAATTGAATGATGCCTAATAACAATAAAAGAATT
TATAAGCTAATAATGAGTAAAAATAAGCTTTGATTGACTAACTCAGCGCAAAAGTTGGTA
AATAATAGAAATAGGTTGAGGATTTAGAAGTTTAATTATCAGAGACTTAAACTAAAATAA
AATAATTATAAGATCAAGTTAATGATTTGGAAGAGTAAAAGTAAAACAAAAATGAAAAAT
TGCAAGAAAAGGAAAAGGAATTATTTGCTGTTCTATCTAAATCTAATGAAAAAGAGTAAA
ATTTAGAAAATTAGTTAGAAGATGTTCGTAGGAAATTGAAAGAAGTAGAAGATAACTTGC
AAAAAGCTCTTAATACCATAGAATAAAAGGAAACTGAACTAAAGCTAATTAAAGAGAGGT
TAACTAAATCAGAAAAATCTGAAAAGAAACTAGAAAAAGAAAGAAATTAAAAGAGTGAAG
AAGTTTAATAGCAATAAAAAGATGTAGAATAATTGTAATAGAGAGTTTAAATTTTAGAAT
AATAAAATTCAGAATATGGAAAGATTATTTAAGGAAAAAGTAATGATTATGATTCAATAA
TAAAGAGTGTTCATAAAGAACTAAATACATAAATAGAAATTGTTTAAACCCATAAAACAC
TCTTAGATAAAGAGTAAAGCGAGCATGAATAAACTAAGAAAGAATTCGAAGATTGGAAGA
ATAAGCTATAAAAAAGTTAAGAAGAGAATAGATTGAAAACAGAAGAGATTTAAAATATCT
AAGACTAGCTTATAGATACACAAAATGAAATAAATTCTTAAGAGGAAACAATAAAAAATC
TAAATAATTAATATGAAAATTTATAAAAATAGAATGAATAATTAAATGAGGAACACAATA
ATTTAAAATCTAAATTGACTTCTTTGAACGAAGAATATTCATTTAAGATAATAAGAATGG
AAGAAACAATTAAAACACTTGAAGAAGAATTGAATTAGCTTAAATAAAATAATTATGACT
TATAATAATTGATTTAAGAGAAAGATAATCTTATTCAAATAAACATTACTAAAATTAATT
AATATGAGTAATAAATTATCAATTTCTAAGAAATTATTTAAGACTAGCAAGATCAAGCTT
AAATTTAAAAGCAATAAATAGAGTTGCAGGCATAAACATAGGAAAGCACTTTAAAAAAGC
AGAATGAATAAGTTATCGCTCAAATTAGAGCTGAATTAGTTAAAGAAAATCTTTAAAATA
TCTAAAATTGTAAAGAAGAAACAGAAATCCATTTCCAAAATATCTTGCAAGAAAAAGAAT
AATAATATCAAGTCTTATTCTAGCAAACCACTTAATCATACGAATCTAAAATTATCTTAA
TATAACAAGAATTCTAAGTAATATTACAATAAAAATTAGAAGAGCTTGAGGCTGCTTAAA
GTGCTATCTTGTAATAAAAGCTAAATGAGCAAGAAGCACAACATTAGAAGGAATTGTAAA
AGCTATTGAAAAATTAATAAAACGAACTACAAAGTAAATTTTAAGAAGAAATGAAACATT
TAGAAGCACAGTATTAAGAAAAATTGAATGAGTAGAGTGAGAACCATAACAAAATATTGA
GTGAACAAGCTAAGTAAATTTAAAATAGTGAAAATCAAAACTTGTCATAAAAGATTATCG
ATTAATAGACTTAATTTGAATAAATTTTATCACAAAAATTAAAAGAATCTGAAGAAATTC
ATAATTAAATTTTATAAGAAAAAATAAAGGAGTGTGAAGGCAATTTCTAGCTTATTCTTT
AAGAAAAAACAATAGAAATTTAAAATGAATAAAATAAGGTTTTATTAGATAAACTCAAAG
AGCAGGAAAGCCAACTCAATAAATAAATTCAATAAAAGCTTAGTGCAGATTTTTAATAAT
AAGTATAAACTTTAGTTGAAAAATAAAAGCAATAAGAAGAGAATTACAATAAAATAATTT
AAGAAAAGGATTAATAAATTGCAAAAATGGATGAAATTTTGAAAGTTAATTCTTAAGAAT
TCTAGCAGGTCTTATAAGAAAAAGAGGCATAGATATTAGAAATTACAAATAATATTAATA
TCATTTAATAATAAAATAATATATAAATTTAACAAATTAATTAATAGCACAAGTAGGAAA
TAAATGAGATAGTATCCTCTAAAAATGAAATTACAAAATATACTAAGTCTTTAGAAGACT
AAATTGCTGAATAGGAAATGAAGAATAAAGATAGAGATTAAGAAGAAAATCAATTAAAAT
AAGAGTTGAAAAAGCAAGAAGATAAAGTCCATGATTTAACTTAGAAGTATTCAAAATTAT
AAACAGAACTAGAAAATTTAAAAGAATAACACTAAGATTACGTTAAGCAGTTATAGAATT
AGCACCTATAAGCTATTCAAGCCAAGGATTCTGATATAGAAAAATTAAATGAAAATGTAA
GAAATTCCAAAAAGAACTCACAAGACTTGCAGCTTCAATTATAGTCCTTGCAATAAACTA
GGCACAACCTTGAAGAATAATTAAATGAATTAAGAACATTAAATAGCAAATCAGCTAATT
AATAAAGTTAATAATTCTCTTAATTACAAGATGAATACAGCGAGCTGCAATAAAACCTTT
AACAAAAGAATCTTCAATTTAAATAAATGCTTAATGAGCATGAAAGCGAAAAGAGTTAAT
TGAATGAAAAAATAACTAAAATTGAGAAATAATTGAAGGATAATTAAACTATTTGCTAAG
AACATTAAAACTTAATAGAATAAAACAATTTAAAAATAAAAGAGTAGCAATAAAAAATTA
AAGAGTATGAAAACTAAATTAGCTAAATGCAGCAATAAAATGAAGAATAAGCTAAAATAC
AATAAAAAGAATAAAATAATTTAGATAAAGAAATAGAAAAATTGAAAAAGCATATTGAAA
GCAATCAAAAGGAAGCTGCTGAATAGCAATAAGAACTAATTAAGAAGCATCAGTAAGAAA
TTGATAACATTCAAAATTAAAATGATATTCATTTGTAATAACAATTAAATTAACTGAAAT
AATAATATGAGGTATAAATTTAATAGATTACTAAATAGTAAAAAGAAGAGGCACAAAAAC
ACAACTAATCAAGTGAATAACAAATTTAATAAATAACTGCTAAATATTAACAAGATATTT
AAAATATCGTTTAATAAAATGAATAAAAAATAGCTGAATTAAATGAAGCCAATAAATAGT
TAAGTTAAAAAGATTCAGATAACCAAATTAAAATACATTAGCTTTAACAAGAATCTGAAA
ATAATTCAACAAATTTTGAAACTAAAATATCTGAAAATAGTAAAATTTATGAAGAAAAAA
TAAGTTAAATTTCAATTACTTTTGAGACTAAAATAACTGAAATAAAATAATCATATGAAA
TATAAATAAATGAGCTGAAATAGCAATATGAGACAAAAATATAATCACTTTAAGAATCTG
AAAAATAGACAAATGAATCAAGTAATAAAGAAAAGCAGGAATTAATTTCAAAATTAAAGG
AAGAATTCTAAAAAGAAATAGCTGAAAAGGATGAAAATCACAATAAATAAGTTAAAGAAA
TTTAAGATAATTTAGATAAATAAATAAATGATTATGAATCTAAAATTAAAGCTTTGCAAG
TTGATTATCAAAAATAAATTGAAGAATCAAAAGCAGACCATGAAAAAAATATTAAAGAAA
TTACTGAAAAATTTGAAAAATAAATTTCTGACTTAAATGAAAGATAATAGAAAGATATTG
AAGGAATCTAAATTAACCACGAATTCATAATAAAAGAGTTATAAAAAAAGATTGAAACTC
TAACAATAACTTTAGATGAAATCAACTAAGAAAAAGAAGATATTGTGAACAAAGCAAAGT
AAAGTTTTATTTTTTTTAGATATTTTATAATTCATTTTAAATTTAGGGAAGAAGCTGAAT
AAGAGATATAGAATATCGATTAGAAGTATAGAAGTTAAATTTAGCAGATGCACAAAGATC
ATAATGATTATATCCTTAATACAGAAAGTGATTAGTAAGATGCAATATAAACTGTTAAAG
AACAATATGAGCTAGAGATTTAGGAACTCAAGCAAATGATACCTTCAGATTCAAATGAAT
TAATATAAAGTAAGAAATAAAAAAATATTTCATGTTGTATTTAATTTTTTTATTACAGAA
TATCTTAATTAGATCAAAGAACTTGAAGAAAAAATATAATAGCTTTAATAATAAGATACT
TAGTCAAATGAAGAAAATTAAAGATTAGAGTTAACAATTATCTAATTAGAAGAAAAAATA
ATTCAAGTTGAAAATAAGTATCAAATACAACTATCCAACGAAAGTGAAAGTCACAAGCAA
TTAATAATTGAGATAGAAACTCAAAATAAAGAAAAAATTGCAGAGTTGTAAAGAATAGAA
AATGAATTAAGAATTCAAATTGCTTCTCTTTTAGGTATGGATGAAAAACAAAAAGTTGAT
CAATAATAAAAAATAAATCAATAAGGTGCTGATAAAGAATAACAAATAGTAATCTTACAA
AAAGAAATTCATACTATAGAGTCAACTTACTAGCTTAGGATATAAGAATTTGAAAAATAA
ATTTAAGATATACAATTAAGGGAATCTCAGAGATATAGTTAATTAGCTTAGAGATACTTA
TTAATTTGTCTTGAATCAGAAAGATTAAAAAGCTCTGCAAATGAAAGAAACTCTTCTTCA
GGCTCTAACACAAGTTAATATTAGAGTAGAATTAATGAATTAGAAATTCAAATTTAAAAC
CATATTGAAGTTATAAGTAAGCTACAGTAAGAGCTTAATATAAGCAGTACTACTATTAAT
CAATAAATCTAAAAAATATAAATTTATGAATAGCAAATTTAATCAAATAATTTCACAGAT
TAAAATCTACTTTAAAAATATCTTATTGTTTGTTTGGAGGCAGAGAGACTTAGGTAAGTT
GCATTAAATTAATCATCTAAATCTATGGCTGTATCAAACTAACCTGTAGATTTTGATAAA
GATTAGTAAATATCTAAACTATAAATATAAGTTTAATAATATGAACACAAAATGTCAGAA
CTACTCATAACAATAAATAGCAAATAAGAATTAATATCTAAATTAGAAACAGAAATCAAT
ATTCATATAGAAAAGGTTAGTATTCTTAATCAATAAATGCAATCATAATAAACTTAATCA
TCTGTTGACACTTAACTTTTATAGAAATATCTTATAGTTTGCTTGGAAGCTGAAAGACTT
AAGTTACAAAAAGGTACTTCTGGTATCAGTATTTAATAAAACTTTAATGATTCAGAGATA
GAAATTTTAAAGTAAAGAGTTATTTAACTTGAACAAGAAGTTATCTACAAGTCTCAGATA
ATTAGTGAATTTGAAGAGAGTAAAGGTGTGAAAAGGTCCACTAAGTCAAGTTAAAATTAG
GAATTGAGCTAACAGTATTTAGTAGTCTGTATGGAAGCAGAGCGTCTCCAATAGTAATTA
TAAAAATAAAAAGCAGATTATGAGAATTAAATAAGCGAACTGATTAAAAAAGATAAAAGA
AACTAAGAATACCTCAAAATAAATGATGCTCAAATTAAGGCCTTAAATGAGAAACTTAAA
TCCTCAAGCTAAAGCTCCTTAAAATCAAATCCATCCTCTCCGGTAAATGAAGATTAAGAT
AATAAAATTAAAGAAATTCAAGCTAAGTTAGAAAAAGCTCAAATGTAGATTGAGAGTTAA
ATGCAAAAAATAGAAAAACTTCACAATGAAAAAATAAATGTTGAGGATTCAAATGCTAAC
TTAAACAGATTTATAAATGATTTGAAGGATTAAAAGTCTTCAATAGAAAAATAACTACAT
TAATTGGAAAAAGAAAATATTGAAAAATCTCATCAAATTGAAAAGCTAGAATAAGAAAAA
ATACTACTTCAAAAATCTGTTGAAGAGTTAGGTGAGAAATTAATTAAAATGCAAATTTAG
TAAAGAGATGAAGAGGAATATGATGACTAAGTATTCGTAGTAAATAGAAAAATGGATGCT
TTAAAGAGTTTAGTAACTCAATTAGAAAGAGATGTAAAGAAGTATGTTGAAACCTCTTAA
ACTATGTAAAGAATAGGTATTTCTTTATTCTCTGTCGATAGAGATTTACCTCTTGAAACC
TTTGTAGAGCAACTAACATAAAATGTAAATGATGTTCTCAAATTCCTTGAACAATAAATA
GATGATAAAGATGCTTAACTTGAAGATCTCCAAAGGAACTTGTAAGCAAAAGATGACTAG
ATCTACTAACTCTAAAACAAGTATTTATTTATTAATTTATTCATTTAATTTATATATAAA
TATTTAATTTATTGAATATCTTTTGAAATGATAAAAAGTCTTGAAAGTCATCAGTAATCA
TTCTTACAAAAAGAATTCTAAACTGGAGAAGATAAAAATATGGAAAAAGTTAATGAAATT
TTAGGTCTTTCTGCTATTGGTGCAGATATTGTTGAATAGAAAAAAGACTAAAGTTTCCTT
TCAGACCATGACATCGAAAACATTGCTATTGAAGATAAAAAAATTTCTGTATAGATTTCC
TATAGAGACAATGATGAAATATAGGAAAGAAACTCAAAGATGGGAGGTAGGCCATCATCT
AATTAAGGATCAGTTTAGCATTCATATAATTAATAATCTTAAAACTAATCCTCAGTGCCA
AATGTTGATAAAAATATAAAAGAATAATATGATCATTAAATATAATCATTAAACGAAGTA
ACTAGATATAAAAATGTGAATAAATATCATTTAAATATATTATTTTTAATTTAAATAGTA
ACATAGATCTATAAAGAGAAAATATGATAACTTATTAATAGAAAATGAAGACTTAAAAAG
AAATCTTTCATCTTTCTATTCTTTGCAAGTAAATAACCCTCTTAATCCTGCTGAAATTAA
TTTGATGAGACAGGAAATGGATTAGTAAAAAATGCAGCTTGACTAATTAAAGGAAGAAAT
TGAAGATCATGAAGAAAATGAAGAAAGGTATTAGCAACAGGTAATTCGTTAAATTAAATT
GATTAATTTAAAAATTTTAATTTCTTTTTAAGTTTTTAATGAAATTTTAATTTAATATAT
AAATTAATATAGATTGGATAATTAAAGAAGAAGATCTTTGAATTAGAAAAGCAGCTCAAA
GAAAGTGTAGCAGGTCATTAATATTAAGCTGTTAAGGATAGCTTTTAGAATTTCTTCAAA
CTTCATTTTGATAAAAAGTAATTAAAATTGCTTATTCAGAGATTAATTTTTTTTAATATT
AAAAGCTCTAAAACTAACGAATTTATTAAAGCAGAAGAATATCTTAAGATCTTACTTAAT
TTACTAAATATCGGAGAATAATAAAAGAAAGAGTGCGTCTTAGTTTATCAGTAAGTGGTG
GCTAATTCTAAAAAATTCAAATTTTTCTGAAATAACTACAGAAGCCATCATAAAAATTAT
ATAGAAGTGTTATTTAATGCTGCTCTATGTTAAAAAAAATTAAAAATTATATAATAAAAT
TTATTTAATTAAAAACTTTAGTCTTGATAATTTATAATTTCATATAGTTAAAATACAAAA
ATATGTTTTTAATAATTCTAATAAATAAACTTTGAAATATATATTAATATCATGTTTATT
ACTTATTGTAAGGATGAAAAGTAGCGCTCTTGTTTCAAATTTTTTTAAACAAATTTTAAT
GAACAACTAAAAGAAATTTACTTTTAATAAAATTCAAAATCAATCCATTATTTATAATTT
TTTTAACAAAAATACTACCTATCTTTCATTATAATTTTATTAAACTTCATAAATTAAATT
TAGTATAAAAAAATATAAAATTCTTTTTTTAAATTGGTTATGA