Identifiers and Description

Gene Model Identifier

TTHERM_00499660

Standard Name

EZL3 (Enhancer of Zeste-Like 3)

Aliases

PreTt08009 | 63.m00187 | 3716.m00041

Description

EZL3 SET domain protein; Enhancer of zeste homolog; putative H3K27 HKMT

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00499660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09665.12.0000012618802033e-84hypothetical protein (446 aa)
WormBaseWBGene000032202.999534586690157e-23locus:mes-2 Histone-lysine N
-methyltransferase mes-2 sta
tus:Confirmed UniProt:O17514
protein_id:CAB05589.2
OxytrichaContig14971.0.g383.001003044337619e-17LNS2 (Lipin/Ned1/Smp2)
Stentor CoeruleusSteCoe_99780.00000000003775134544279098
SGDYJL168C0.000000030002053728821195SET2 Histone methyltransferase
with a role in transcriptiona
l elongation, methylates a lys
ine residue of histone H3; ass
ociates with the C-terminal do
main of Rpo21p; histone methyl
ation activity is regulated by
phosphorylation status of Rpo
21p
DictyBaseDDB_G02681320.0000007001298633766835DDB_G0268132 on chromosome: 1
position 1516724 to 1519586

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25161194: Papazyan R, Voronina E, Chapman JR, Luperchio TR, Gilbert TM, Meier E, Mackintosh SG, Shabanowitz J, Tackett AJ, Reddy KL, Coyne RS, Hunt DF, Liu Y, Taverna SD (2014) Methylation of histone H3K23 blocks DNA damage in pericentric heterochromatin during meiosis. eLife 3( ):e02996
  2. Ref:17575054: Liu Y, Taverna SD, Muratore TL, Shabanowitz J, Hunt DF, Allis CD (2007) RNAi-dependent H3K27 methylation is required for heterochromatin formation and DNA elimination in Tetrahymena. Genes & development 21(12):1530-45

Sequences

>TTHERM_00499660(coding)
ATGTAGTAACCAAACAAAGATACAATATCAGATTTTATAGATTAGAAATAAGAAAAAATT
ATAGAAAAAGTATTAAATATTAGCATAACGTAATAAGAACCTAATGAAAAGTATTTAAAG
TCTATGGAAATCATATAAAAGGCTACATAAAAATTTTTCAATGACCTTTGCTTATAAATT
ATTAGGTTAAGTATTTGGAGTTATAAAATGAGAAGAGTTAGATAAAATAAATGTTTAAAG
TATTAAATTTAAAAGAAAGAATCAATAGCTAAACAATTCTTTAATAACTGGAAGAATAAG
CCTTATCTTAAAAAGAAATAACTCCACATAATTGATAAATCAAATGATGTAATTTAATCT
AACATGTATTCTAATTACATGCCTGTTTCACAAAACGTCTAAACTGATGATTTTTTACTG
TAGCTTTTTCCAGTTATTGAAAGAATTGATTTATACCAAATTGTGAATGAGCTTAAAATG
AAAGAATCTTTATCTGAAAAAAAGAGATTTAAAAAGTGGTTCAAAATTATTAAAAAAATG
AATTTATTAGTTGACATAGAATAAAAGATTTGGATATGGTATATTTACAAGACTTATAAA
AAAACGTTGGGATGCACAAGCTTCATGCAAATTTTTTTTTAATAACCTCAAGTTAAATAA
TAGAATTTTGCTTTAAAATATTTAGATATTAAAAGAATGGTTGAATAGAAAGAATACAAA
TATGGAATTACCATAGAAAAAAAAAATAACGAACACATTGATCCTATCATAGATTTAACT
GCTATGTCTAAGTAATATTACTGCAATATTTGCTATATTTACGATTGCAGGATTCACTTT
TATGAACGAAAAAAAGGTTAAGATTTTTATCATCCAAGCACTTTTGTTCAAAATACTTAA
TAATATTCTGAAAGAATGATTTAATATTTGGTTGATATTTACTAGAAAATGGTTTTTGAT
ATTAATTACTCATTTATGCCAACGTAGGCTGATACATATTGTGGTAAATTTTGCTATAAA
AGGCTTACAAAAGAGAAAATAAAATAAATTAAAGAGAGCTTAAATTATCCTATTTAATTT
TCAGATTTAGATAAGTTATTTATAAAATTAGGGGAATAAAGATTTTATTTTAATATTTGC
TAAATGTCTCTATTGTAATTAAGTTTTAGATGTGATTTGTTATTTATATATTTAGTAGAG
TAGTTTATGCAAAGCTATGAAAGTGAAAATTTTTAGATTTTAAATGACTAGTTTAAATAA
AAATAAGATTAGATATAATTAAAATAAGAATAAAACTTAATGAGTAATTCTATTTTAAAC
TAATCTTCTAATACTCCAAATACTTCTTAATAGAAATTCTAAGTTAAGAAAAACTTTGAT
GATAACGATGACGATGAAGACCCATGGCTTCTTGAAGAAGAAGAAAATGAAAATGAAATT
AATCCTAGTTAATATGAAAATACTCAAAAATAATTAAATTTGGCAGAAAAATTGAAATTG
AAGGTTGAAGAAGATAATAATTAGAATTTTATGCATAAACTAAAAGAGTTTGTGGTTAGC
AACTACACTGTTTAAGAGGTAAATATAAAATAGGAAAAAATAAAATAAGAAAAATTGAAA
GCTCTAATTAGAAAATCTCAATCTTTCTTAGTTAAACCTGAAGTTATGTAAGAAGAATCT
GATGAAGATGAAGGATTATAAAAAGAGAATAATTAACAAAAAAAAGGTGATAAGGAATCA
AAAGAAGATCAAGATGAGTGTTATGGGTATACAAATACCTAAAACGAAACACAATTAGAT
GATAGCTATTAACATTGTGTGCACTATAGGCACAACAGAAAGCCAGTGGACACAAGCTGT
AAAAAATGCTGTTGTAGAAAAAGAGGATTCTGTGATTAATATTGCATGTGTGATCCTAAA
AAATGCAAAATTTATAGGTTTGGATGTAATTGTTAAGACAATTGTTCTAAAAACACATGC
ATATGTTTTAAGAGAAATGTAGAATGTGATCCAGATATATGTAAATCGTGTTTTGAATGC
AAATCTAAATGTAATAACAATCAGATCACACTTAACAAAGTCTAAAGAGTTGTAATAGCT
AATTCAGAAATTTGTGGAGGTCTAGGAATATACAATGTTTATCCTTTGTAAAAAGGAGAT
CTTATAACTATTTATTATGGAGAAGTACTTTAGGATTTAGACATTATAATTAGAGATTCT
TGGAAACCTTCCAATTTATTTTATATTTTTTCTTTATTGGGAGATTTAACAGTTGACTCT
AAATATATTGGAAATAAAAGCAGATTCATGAATCATTCAAAAAGCAAAGAGAATTCTTAT
GCTAAAATGGTCTATGCTAAAGGTGGATACACTATAGGTCTTTTTTCAAATGAAAAAATA
ATACCTGGCACAGAGCTGCTATTTGATTATGATGGACAAGGAACTCTCAAATTAAAATAT
GAATGGATTATGTAAAAGGCAGACTCAAAAGCCAAATAAATTCAAGAAGATAATATAATT
GTGTTTGAAGCTCATAATTCACCTGCTAAAAATTAAAATTTAATAAAATAAAAAAAAAGG
AAATGA


>TTHERM_00499660(protein)
MQQPNKDTISDFIDQKQEKIIEKVLNISITQQEPNEKYLKSMEIIQKATQKFFNDLCLQI
IRLSIWSYKMRRVRQNKCLKYQIQKKESIAKQFFNNWKNKPYLKKKQLHIIDKSNDVIQS
NMYSNYMPVSQNVQTDDFLLQLFPVIERIDLYQIVNELKMKESLSEKKRFKKWFKIIKKM
NLLVDIEQKIWIWYIYKTYKKTLGCTSFMQIFFQQPQVKQQNFALKYLDIKRMVEQKEYK
YGITIEKKNNEHIDPIIDLTAMSKQYYCNICYIYDCRIHFYERKKGQDFYHPSTFVQNTQ
QYSERMIQYLVDIYQKMVFDINYSFMPTQADTYCGKFCYKRLTKEKIKQIKESLNYPIQF
SDLDKLFIKLGEQRFYFNICQMSLLQLSFRCDLLFIYLVEQFMQSYESENFQILNDQFKQ
KQDQIQLKQEQNLMSNSILNQSSNTPNTSQQKFQVKKNFDDNDDDEDPWLLEEEENENEI
NPSQYENTQKQLNLAEKLKLKVEEDNNQNFMHKLKEFVVSNYTVQEVNIKQEKIKQEKLK
ALIRKSQSFLVKPEVMQEESDEDEGLQKENNQQKKGDKESKEDQDECYGYTNTQNETQLD
DSYQHCVHYRHNRKPVDTSCKKCCCRKRGFCDQYCMCDPKKCKIYRFGCNCQDNCSKNTC
ICFKRNVECDPDICKSCFECKSKCNNNQITLNKVQRVVIANSEICGGLGIYNVYPLQKGD
LITIYYGEVLQDLDIIIRDSWKPSNLFYIFSLLGDLTVDSKYIGNKSRFMNHSKSKENSY
AKMVYAKGGYTIGLFSNEKIIPGTELLFDYDGQGTLKLKYEWIMQKADSKAKQIQEDNII
VFEAHNSPAKNQNLIKQKKRK


>TTHERM_00499660(gene)
ATGTAGTAACCAAACAAAGATACAATATCAGATTTTATAGATTAGAAATAAGAAAAAATT
ATAGAAAAAGTATTAAATATTAGCATAACGTAATAAGAACCTAATGAAAAGTATTTAAAG
TCTATGGAAATCATATAAAAGGCTACATAAAAATTTTTCAATGACCTTTGCTTATAAGTA
ATTTAAGATTTATTTGGCGCAATAAATTAATCATTTTATTTATAAGATTATTAGGTTAAG
TATTTGGAGTTATAAAATGAGAAGAGTTAGATAAAATAAATGTTTAAAGTATTAAATTTA
AAAGAAAGAATCAATAGCTAAACAATTCTTTAATAACTGGAAGAATAAGCCTTATCTTAA
AAAGAAATAACTCCACATAATTGATAAATCAAATGATGTAATTTAATCTAACATGTATTC
TAATTACATGCCTGTTTCACAAAACGTCTAAGTAAATAATTATAAAGTCAATTTAGATAG
TTATCTTTCATAATTTAAAAAATTAGACTGATGATTTTTTACTGTAGCTTTTTCCAGTTA
TTGAAAGAATTGATTTATACCAAATTGTGAATGAGCTTAAAATGAAAGAATCTTTATCTG
AAAAAAAGAGATTTAAAAAGTGGTTCAAAATTATTAAAAAAATGAATTTATTAGTTGACA
TAGGTATCTTTAAATTTAAAATTAGCTTGGAGTTTTATTATAAATTTTTAAAGAATAAAA
GATTTGGATATGGTATATTTACAAGACTTATAAAAAAACGTTGGGATGCACAAGCTTCAT
GCAAATTTTTTTTTAATAACCTCAAGTTAAATAATAGAATTTTGCTTTAAAGTAAATTTT
TAGCATATTCTTAAATTTTAATGCAATTATTAATTTAGATATTTAGATATTAAAAGAATG
GTTGAATAGAAAGAATACAAGTAAGTATTTAATTTTTGGTATTAAACTTTCATCTATGTC
TTCCTAATTAATTAATATAGATATGGAATTACCATAGAAAAAAAAAATAACGAACACATT
GATCCTATCATAGATTTAACTGCTATGTCTAAGTAATATTACTGCAATATTTGCTATATT
TACGATTGCAGGATTCACTTTTATGAACGAAAAAAAGTAATTAATTTATTTGTAATTTTT
TTAGAGATTTTCTTTGATATTTTTCTATATAAATTTAGAGAGTTTTTAAAAAACTATTTA
AAATTAAGAATAGTTTTTTAAATAATCTTAGAAAATATAGTTAAAGATTTTTTGAATTTT
TATAAGGATATGATTTTACTTTTTTTAATATTTAACTTGAATAGCTTTTTAATCTAATTT
GATTGTGTGTGTATGTTTACAATTTATAATTTAGTAAAAATAATATTTATTTCATATTTA
TATTGAAATGTAATTTAATAGGGTTAAGATTTTTATCATCCAAGCACTTTTGTTCAAAAT
ACTTAATAATATTCTGAAAGAATGATTTAATATTTGGTTGATATTTACTAGAAAATGGTT
TTTGATATTAATTACTCATTTATGCCAACGTAGGCTGATACATATTGTGGTAAATTTTGC
TATAAAAGGCTTACAAAAGAGAAAATAAAATAAGTAAAATTTTAATGAAATAAATATATT
TTTAATATATTTTTTTTTTAGATTAAAGAGAGCTTAAATTATCCTATTTAATTTTCAGAT
TTAGATAAGTTATTTATAAAATTAGGGGAATAAAGATTTTATTTTAATATTTGCTAAATG
TCTCTATTGTAATTAAGTTTTAGATGTGATTTGTTATTTATATATTTAGTAGAGTAGTTT
ATGCAAAGCTATGAAAGTGAAAATTTTTAGATTTTAAATGACTAGTTTAAATAAAAATAA
GATTAGATATAATTAAAATAAGAATAAAACTTAATGAGTAATTCTATTTTAAACTAATCT
TCTAATACTCCAAATACTTCTTAATAGAAATTCTAAGTTAAGAAAAACTTTGATGATAAC
GATGACGATGAAGACCCATGGCTTCTTGAAGAAGAAGAAAATGAAAATGAAATTAATCCT
AGTTAATATGAAAATACTCAAAAATAATTAAATTTGGCAGAAAAATTGAAATTGAAGGTT
GAAGAAGATAATAATTAGAATTTTATGCATAAACTAAAAGAGTTTGTGGTTAGCAACTAC
ACTGTTTAAGAGGTAAATATAAAATAGGAAAAAATAAAATAAGAAAAATTGAAAGCTCTA
ATTAGAAAATCTCAATCTTTCTTAGTTAAACCTGAAGTTATGTAAGAAGAATCTGATGAA
GATGAAGGATTATAAAAAGAGAATAATTAACAAAAAAAAGGTGATAAGGAATCAAAAGAA
GATCAAGATGAGTGTTATGGGTATACAAATACCTAAAACGAAACACAATTAGATGATAGC
TATTAACATTGTGTGCACTATAGGCACAACAGAAAGCCAGTGGACACAAGCTGTAAAAAA
TGCTGGTAAATTTAATTTACAATTTATTTTAAAATAGTGATTGTGAATAATTAATTAAAA
TTAAAGTTGTAGAAAAAGAGGATTCTGTGATTAATATTGCATGTGTGATCCTAAAAAATG
CAAAATTTATAGGTTTGGATGTAATTGTTAAGACAATTGTTCTAAAAACACATGCATATG
TTTTAAGAGAAATGTAGAATGTGATCCAGATGTAAAATAGCTTTTATAATAACATTAATA
TAAAATTCAACTATTTTTTAAGATATGTAAATCGTGTTTTGAATGCAAATCTAAATGTAA
TAACAATCAGATCACACTTAACAAAGTCTAAGTAATAATTATATTTTTTATTTTGATTTA
ATTATTTTGATTTTTTTTTCTATTTAATTTAAGAGAGTTGTAATAGCTAATTCAGAAATT
TGTGGAGGTCTAGGAATATACAATGTTTATCCTTTGTAAAAAGGAGATCTTATAACTATT
TATTATGGAGAAGTACTTTAGGATTTAGACATTATAATTAGAGATTCTTGGAAACCTTCC
AATTTATTTTATATTTTTTCTTTATTGGGAGATTTAACAGTTGACTCTAAATATATTGGA
AATAAAGTAAGATTGAACAAAAAATTGTTTACAAAAATATTTATTTTTTCTATTTTTCTT
TACACTAATAAAGAGCAGATTCATGAATCATTCAAAAAGCAAAGAGAATTCTTATGCTAA
AATGGTCTATGCTAAAGGTGGATACACTATAGGTCTTTTTTCAAATGAAAAAATAATACC
TGGCACAGAGCTGCTATTTGATTATGATGGACAAGGAACTCTCAAATTAAAATATGAATG
GATTATGTAAAAGGCAGACTCAAAAGCCAAATAAATTCAAGAAGATAATATAATTGTGTT
TGAAGCTCATAATTCACCTGCTAAAAATTAAAATTTAATAAAATAAAAAAAAAGGAAATG
A