Identifiers and Description

Gene Model Identifier

TTHERM_00300320

Standard Name

EZL2 (Enhancer of zeste-like 2)

Aliases

PreTt19327 | 28.m00286 | 3691.m00104

Description

Enhancer of zeste homolog, putative H3K27 HKMT

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00300320

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07665.19.997093137033517e-262SET domain-containing protein
(570 aa)
WormBaseWBGene000032202.000130478826482e-26locus:mes-2 Histone-lysine N
-methyltransferase mes-2 sta
tus:Confirmed UniProt:O17514
protein_id:CAB05589.2
OxytrichaContig14971.0.g380.0000000000000030004923591262316LNS2 (Lipin/Ned1/Smp2)
DictyBaseDDB_G02681320.00000000000009996062864481225DDB_G0268132 on chromosome: 1
position 1516724 to 1519586
SGDYHR119W0.0000009995106777214876SET1 Histone methyltransferase
, subunit of the COMPASS (Set1
C) complex; COMPASS methylates
histone H3K4; Set1p-dependent
H3K4 trimethylation recruits
Nrd1p, allowing efficient term
ination of snoRNAs and cryptic
unstable transcripts (CUTs) b
y Nrd1p-Nab3p-Sen1p pathway; m
odulates histone acetylation l
evels in promoter proximal reg
ions to ensure efficient Nrd1p
-dependent termination; requir
ed in transcriptional silencin
g near telomeres and at silent
mating type loci; has a SET d
omain

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25161194: Papazyan R, Voronina E, Chapman JR, Luperchio TR, Gilbert TM, Meier E, Mackintosh SG, Shabanowitz J, Tackett AJ, Reddy KL, Coyne RS, Hunt DF, Liu Y, Taverna SD (2014) Methylation of histone H3K23 blocks DNA damage in pericentric heterochromatin during meiosis. eLife 3( ):e02996
  2. Ref:24382802: Zhang C, Gao S, Molascon AJ, Liu Y, Andrews PC (2014) Quantitative proteomics reveals histone modifications in crosstalk with H3 lysine 27 methylation. Molecular & cellular proteomics : MCP 13(3):749-59
  3. Ref:23150054: Zhang C, Molascon AJ, Gao S, Liu Y, Andrews PC (2013) Quantitative proteomics reveals that the specific methyltransferases Txr1p and Ezl2p differentially affect the mono-, di- and trimethylation states of histone H3 lysine 27 (H3K27). Molecular & cellular proteomics : MCP 12(6):1678-88
  4. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79
  5. Ref:22427430: Chung PH, Yao MC (2012) Tetrahymena thermophila JMJD3 homolog regulates H3K27 methylation and nuclear differentiation. Eukaryotic cell 11(5):601-14
  6. Ref:17575054: Liu Y, Taverna SD, Muratore TL, Shabanowitz J, Hunt DF, Allis CD (2007) RNAi-dependent H3K27 methylation is required for heterochromatin formation and DNA elimination in Tetrahymena. Genes & development 21(12):1530-45

Sequences

>TTHERM_00300320(coding)
ATGATTGAAGAATTAAAAGAATAAGCAAGCACATGTCAATAAAATAAGCCATTGTAAGAA
GCTGATGAATTAAATTAGAAATTAGATTCAGTAGAACATCTTTCTGCTGATACAAGCAAA
TATGTAGATTTTATGAAATGCGATAAAGAATAGTAGAAAAAGATCATTATTTAAACTTTG
GAATTCACAATTAAGTATATAGAAATGAATTTCAAAAACTTAATCTGTCATATAGTATAA
AAAGCCATTATATACAATAAGCAAAGATAAGAGCTAATTGATAATGACCCATTCAAAAAA
TACAAAAGAGATATGAAGCAATAAGTTGTTAAGAATTTTTTTAAAAATCGAATTCAACAA
AGCAAATAAGAACAAAAAGTATTGATTAAATATGACTTTGAAAAAAATTTAAAAGAATCC
TGCTTGATTAACCATAATATTTACTCAAATTACATTCCTATAAGAAAGAATTTAGTGGTT
GGAGAAATTATGCCTAATCTATTTCCATGTTTAAAAATAATTAACAATGATGGTGAAGAT
GAAAATAACTAGTTGATATAAGAATTTTAAATTAAAAATAGTAAGAATAAAACAAGAGAA
GATCTATTCAATGAATGGCTCTTAAAAAAGAATGCCCATGTGCTTTTCGTAGACATAAGG
GAAACTCTTCTTATTGATTTTTTGCTTAATCTATTTCCTTAGCTCAAGCTAGAAGTAATA
GATATATTAAGAATATATATTTAATAAGAAAAAGTTAAACAAGAGGCTTTTGATGAAAAA
ATATAATATGTTTTACAAAATTATTGTGATCCAATTTAATATCCCTATGGTATTACTATT
GATGATAAAATAATCACTGACTAATCTGTAACATCAACTTTTAAATCTTTCTTTTGCCAT
AGATGTTATTTATACGACTGTAGAAATCATGAAAATAAAAAAGAATTAAATTTTAAGCAT
CCTGCTACTCAGCTTAGTGATGCCAGTAATAATAAAGAAATAAAGTGGTTGTAGCTTTTT
TATAAAGAAATACTTTTGACAAATTAAAAATATAAATATGTAGCAGATGTGGAGCAAAGG
ACAGAATCTTATTATTAAGATTATGATATGAAATAAATCAATAAATAACCTTGTAGTAAA
AATTGCTATTTGAATATGAATCTTGAAACTTTCGAAAAAATTAAAGCTCAAAAAACATAT
AATGAATTCGAATTAGCTTACATTAAGGCAGCGATAAAGCGTTTATCTTACAACCCTTGC
TATCTCAATTTAATTGACAGAAAATTTAATTGTGCTGAAATTTTTGTGTTTTTAGTTAAA
TATGAGAATGTTTTATCAATGCTTTCAGAAACAAAAGCTATTACAAAAAAAATTAAGCCA
TACGCCAGAAGAACAAATAATTGTTTTTTTAACAAAGAAATGTACTATGAGCCTTGCTGT
CATTATTATTATGACGAAGAACCAAAAGATATAAACTGCTAAGATTGTGGTTGCTCAACA
AGAGGTTTTTGTGATATTTATTGTGGTTGTGATCCATAAAAGTGTAAGAGAAGAAGATAA
GGTTGCAAATGCATAAAAGGTTAATGCAAAACAAAAAAATGTGCATGCTTCTTGATGGGT
ATGGAATGTGATCCAGAGCATTGTAAGGACTGCTTTGATTCTAGAAAAGATAGATGCAAA
AATAATGAGTACTTGTACTAAAAATAAGAAAGAACCGTCATAGGTATGTCATTTGTGTGC
TAAGGACTAGGCCTTTATAATGTTTTTCCGATTTAATAACATTCTTTAGTCTTATCTTAT
TTAGGAGAATACATCAGCGAAGATGAATAAGTTATCAGAGAAAGCTGGCTGAAGTCAGAT
ATTTTTTACACTTTTACTAAAAATGATTTCGAGAAGTTAGTTGATTCAAAATATTTTGGA
AATAAGAGTCGTTTTATGAATCATCATATTTCTTTAGAAAATTGTTTTGCTCGTAGCGTT
TATAGTAGAGGAGATTATCACTTAGGATTATATGCTAAGCAAGATATTCCTCCTGGCAAC
GAACTTCTTTTTGACTATGACGCGGATAAAACATTGGCAGTGGAAAAGGAGTGGATTACA
CGTAATAATTATTCGAATTACAAGATAAGAATGGATAACATAAGAATAACTATTCCAAGA
AATAAAGATCTTACAAGATTTAATTCAACCTTGATTATAATAGATGATGAAAATGATAAT
CAGTAAAAGAATTAAAAAAATGATCTTCAGGTTGATGAACATAAAAAATTCAATAATAAT
AAATTAGAAAAAGTATCTTTTAAAAAACAATGTAAGAAGTAACATCCAGAATCTATAGTA
GGATAAAAAAAAACAAATAAAATTTTATCAGATTAAAGTTTAAATTATTTAAAAAAATAA
AATAAAAACTTTGAAAAGTAATGA


>TTHERM_00300320(protein)
MIEELKEQASTCQQNKPLQEADELNQKLDSVEHLSADTSKYVDFMKCDKEQQKKIIIQTL
EFTIKYIEMNFKNLICHIVQKAIIYNKQRQELIDNDPFKKYKRDMKQQVVKNFFKNRIQQ
SKQEQKVLIKYDFEKNLKESCLINHNIYSNYIPIRKNLVVGEIMPNLFPCLKIINNDGED
ENNQLIQEFQIKNSKNKTREDLFNEWLLKKNAHVLFVDIRETLLIDFLLNLFPQLKLEVI
DILRIYIQQEKVKQEAFDEKIQYVLQNYCDPIQYPYGITIDDKIITDQSVTSTFKSFFCH
RCYLYDCRNHENKKELNFKHPATQLSDASNNKEIKWLQLFYKEILLTNQKYKYVADVEQR
TESYYQDYDMKQINKQPCSKNCYLNMNLETFEKIKAQKTYNEFELAYIKAAIKRLSYNPC
YLNLIDRKFNCAEIFVFLVKYENVLSMLSETKAITKKIKPYARRTNNCFFNKEMYYEPCC
HYYYDEEPKDINCQDCGCSTRGFCDIYCGCDPQKCKRRRQGCKCIKGQCKTKKCACFLMG
MECDPEHCKDCFDSRKDRCKNNEYLYQKQERTVIGMSFVCQGLGLYNVFPIQQHSLVLSY
LGEYISEDEQVIRESWLKSDIFYTFTKNDFEKLVDSKYFGNKSRFMNHHISLENCFARSV
YSRGDYHLGLYAKQDIPPGNELLFDYDADKTLAVEKEWITRNNYSNYKIRMDNIRITIPR
NKDLTRFNSTLIIIDDENDNQQKNQKNDLQVDEHKKFNNNKLEKVSFKKQCKKQHPESIV
GQKKTNKILSDQSLNYLKKQNKNFEKQ


>TTHERM_00300320(gene)
ATGATTGAAGAATTAAAAGAATAAGCAAGCACATGTCAATAAAATAAGCCATTGTAAGAA
GCTGATGAATTAAATTAGAAATTAGATTCAGTAGAACATCTTTCTGCTGATACAAGCAAA
TATGTAGATTTTATGAAATGCGATAAAGAATAGTAGAAAAAGATCATTATTTAAACTTTG
GAATTCACAATTAAGTATATAGAAATGAATTTCAAAAACTTAATCTGTCATGTAAATAAA
TTAATTAATTATAAAAGCTGTAGTTTGATATTATTTTTAAATGCTTATTTATATAATAAA
GATAGTATAAAAAGCCATTATATACAATAAGCAAAGATAAGAGCTAATTGATAATGACCC
ATTCAAAAAATACAAAAGAGATATGAAGCAATAAGTTGTTAAGAATTTTTTTAAAAATCG
AATTCAACAAAGCAAATAAGAACAAAAAGTATTGATTAAATATGACTTTGAAAAAAATTT
AAAAGAATCCTGCTTGATTAACCATAATATTTACTCAAATTACATTCCTATAAGAAAGAA
TTTAGTGGTAAAAATCATTCTATTTTTAATATTATTTACTTTATAATTTAATTTGTTTAG
CAAAAATATACTGTTTACTAAATATAATCAATTTTTTATAGCTATTAAAAATGATTTTTA
AAGTTTTTTATTTGTCCTTTTTTCAATAGTTTGTCTATTTTAGCTGAGTTATAAATAAAA
TTATTATTATTTTTGATAAATATTATCTTTATGCATTTATTTGTAATCTATCTAGGTTGG
AGAAATTATGCCTAATCTATTTCCATGTTTAAAAATAATTAACAATGATGGTGAAGATGA
AAATAACTAGTTGATATAAGAATTTTAAATTAAAAATAGTAAGAATAAAACAAGAGAAGA
TCTATTCAATGAATGGCTCTTAAAAAAGAATGCCCATGTGCTTTTCGTAGACATAAGTTG
ATTTATTTATTAATTGTTTTGAAAAATAATTGATTTAATATTTTTAAAACTAAATTTAAA
GGGGAAACTCTTCTTATTGATTTTTTGCTTAATCTATTTCCTTAGCTCAAGCTAGAAGTA
ATAGATATATTAAGAATATATATTTAATAAGAAAAAGTTAAACAAGAGGCTTTTGATGAA
AAGTAAAATAAATTAAAAAATTTTAATTTACATTTTTTATTTTGATAAAATAACTTATAT
TTATGCTTAATAAAAAATAGAATATAATATGTTTTACAAAATTATTGTGATCCAATTTAA
TATCCCTATGGTATTACTATTGATGATAAAATAATCACTGACTAATCTGTAACATCAACT
TTTAAATCTTTCTTTTGCCATAGATGTTATTTATACGACTGTAGAAATCATGAAAATAAA
AAAGTATTTATGAATTTATTTGTTAATTTACTCATTTAATTCAAATTTTTGTTAAAAATA
ATCATATTAGGAATTAAATTTTAAGCATCCTGCTACTCAGCTTAGTGATGCCAGTAATAA
TAAAGAAATAAAGTGGTTGTAGCTTTTTTATAAAGAAATACTTTTGACAAATTAAAAATA
TAAATATGTAGCAGATGTGGAGCAAAGGACAGAATCTTATTATTAAGATTATGATATGAA
ATAAATCAATAAATAACCTTGTAGTAAAAATTGCTATTTGAATATGAATCTTGAAACTTT
CGAAAAAGTAAAATTAAATATTAAATCAAAATTAAAATAAAAATATAAATTTAAAAAATG
AAAAATTTTATTTTAAGAAATTTATAAATCAAATTAAACTCTTAAATTAAAATAAATTAA
TAGATTAAAGCTCAAAAAACATATAATGAATTCGAATTAGCTTACATTAAGGCAGCGATA
AAGCGTTTATCTTACAACCCTTGCTATCTCAATTTAATTGACAGAAAATTTAATTGTGCT
GAAATTTTTGTGTTTTTAGTTAAATATGAGAATGTTTTATCAATGCTTTCAGAAACAAAA
GCTATTACAAAAAAAATTAAGCCATACGCCAGAAGAACAAATAATTGTTTTTTTAACAAA
GAAATGTACTATGAGCCTTGCTGTCATTATTATTATGACGAAGAACCAAAAGATATAAAC
TGCTAAGATTGTGGGTAAAATCTCTTTTCTTAATATCAATTAGCGAATTATATAAAATAA
AATAGTTGCTCAACAAGAGGTTTTTGTGATATTTATTGTGGTTGTGATCCATAAAAGTGT
AAGAGAAGAAGATAAGGTTGCAAATGCATAAAAGGTTAATGCAAAACAAAAAAATGTGCA
TGCTTCTTGATGGGTATGGAATGTGATCCAGAGGTATCATGCAATTTTAATTATTTTATA
AATTTTTTATGCAAATTGTAATATTTAAATAGCATTGTAAGGACTGCTTTGATTCTAGAA
AAGATAGATGCAAAAATAATGAGTACTTGTACTAAAAATAAGAAGTAATTTATTTAAATA
AAAATCCAAATTTATTTTATTTTATGCTATCAAAGAGAACCGTCATAGGTATGTCATTTG
TGTGCTAAGGACTAGGCCTTTATAATGTTTTTCCGATTTAATAACATTCTTTAGTCTTAT
CTTATTTAGGAGAATACATCAGCGAAGATGAATAAGTTATCAGAGAAAGCTGGCTGAAGT
CAGATATTTTTTACACTTTTACTAAAAATGATTTCGAGAAGTTAGTTGATTCAAAATATT
TTGGAAATAAGGTAAAACAATCAATCAATCTATTCTTTTAACTTTTAGATATTATGGATG
TTTCAAATTTTTATAACATTTATTTCAACAGAGTCGTTTTATGAATCATCATATTTCTTT
AGAAAATTGTTTTGCTCGTAGCGTTTATAGTAGAGGAGATTATCACTTAGGATTATATGC
TAAGCAAGATATTCCTCCTGGCAACGAACTTCTTTTTGACTATGACGCGGATAAAACATT
GGCAGTGGAAAAGGAGTGGATTACACGTAATAATTATTCGAATTACAAGATAAGAATGGA
TAACATAAGAATAACTATTCCAAGAAATAAAGATCTTACAAGATTTAATTCAACCTTGAT
TATAATAGATGATGAAAATGATAATCAGTAAAAGAATTAAAAAAATGATCTTCAGGTTGA
TGAACATAAAAAATTCAATAATAATAAATTAGAAAAAGTATCTTTTAAAAAACAATGTAA
GAAGTAACATCCAGAATCTATAGTAGGATAAAAAAAAACAAATAAAATTTTATCAGATTA
AAGTTTAAATTATTTAAAAAAATAAAATAAAAACTTTGAAAAGTAATGA