Identifiers and Description

Gene Model Identifier

TTHERM_00335780

Standard Name

EZL1 (Enhancer of Zeste-Like 1)

Aliases

PreTt06023 | 34.m00260 | 3689.m00057

Description

EZL1 SET domain protein; Conjugation-specific H3K27 HKMT; responsible for H3K27 methylation associated with developmentally regulated heterochromatin formation and DNA elimination; Ezl1p-catalyzed H3K27 methylation occurs in an RNAi-dependent manner

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00856 ) SET domain
  • ( PF05033 ) Pre-SET motif
  • ( PF08674 ) Acetylcholinesterase tetramerisation domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00335780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16080.19.997093137033517e-262hypothetical protein (798 aa)
OxytrichaContig14971.0.g381.0002124404074584e-26LNS2 (Lipin/Ned1/Smp2)
WormBaseWBGene000032200.000000000003001226732525078locus:mes-2 Histone-lysine N
-methyltransferase mes-2 sta
tus:Confirmed UniProt:O17514
protein_id:CAB05589.2
DictyBaseDDB_G02695540.00000000009998509410508463suvA on chromosome: 1 position
2983180 to 2987875
SGDYHR119W0.00000039992052383199455SET1 Histone methyltransferase
, subunit of the COMPASS (Set1
C) complex; COMPASS methylates
histone H3K4; Set1p-dependent
H3K4 trimethylation recruits
Nrd1p, allowing efficient term
ination of snoRNAs and cryptic
unstable transcripts (CUTs) b
y Nrd1p-Nab3p-Sen1p pathway; m
odulates histone acetylation l
evels in promoter proximal reg
ions to ensure efficient Nrd1p
-dependent termination; requir
ed in transcriptional silencin
g near telomeres and at silent
mating type loci; has a SET d
omain

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:30808657: Zhao X, Xiong J, Mao F, Sheng Y, Chen X, Feng L, Dui W, Yang W, Kapusta A, Feschotte C, Coyne RS, Miao W, Gao S, Liu Y (2019) RNAi-dependent Polycomb repression controls transposable elements in Tetrahymena. Genes & development 33(5-6):348-364
  2. Ref:29021213: Noto T, Mochizuki K (2017) Whats, hows and whys of programmed DNA elimination in Tetrahymena. Open biology 7(10):
  3. Ref:25161194: Papazyan R, Voronina E, Chapman JR, Luperchio TR, Gilbert TM, Meier E, Mackintosh SG, Shabanowitz J, Tackett AJ, Reddy KL, Coyne RS, Hunt DF, Liu Y, Taverna SD (2014) Methylation of histone H3K23 blocks DNA damage in pericentric heterochromatin during meiosis. eLife 3( ):e02996
  4. Ref:22427430: Chung PH, Yao MC (2012) Tetrahymena thermophila JMJD3 homolog regulates H3K27 methylation and nuclear differentiation. Eukaryotic cell 11(5):601-14
  5. Ref:17575054: Liu Y, Taverna SD, Muratore TL, Shabanowitz J, Hunt DF, Allis CD (2007) RNAi-dependent H3K27 methylation is required for heterochromatin formation and DNA elimination in Tetrahymena. Genes & development 21(12):1530-45

Sequences

>TTHERM_00335780(coding)
ATGGATCCAAAATTTGAAATATAGCTCAGAGCTTAAGAGTAAGATTTATAGGAATAAAAT
TTCTTCAATTTGGATATAAATGATCAATAGAAAATTAAGGAAGGGATGGTAAAGGTTATT
GCTTCTGCATATATTAGGTTTAAAATGGCTTTTAGAGCTTGTTGCTGGAAAGGGTACAGC
GATAATGATATCTATATTTAATAGAATTTACAAAAAGGCATCGCTGAACACTAAAATAAA
GTAAAAAGAATAAAAAAAAAGGTATAGAATTTTTTTCAGTCTGAGATGTCTATTGAGCCT
CACTAATTTGTGGTTTAAATACTTAAAAACAGAGATTAAGTTTATTCAGGTGGTATTTTC
TAACATGTAAACTCATATGTGCAAATAAACGAATCTATAAAAGATGAAAAAACAAAATAT
CTCTACAGAGATGTTGAAAATATAGGTTTGAAAAAATCTGACCAAGTAAATCACTAAGAG
AGTTAGCAAGCTAAGCAATTAAAAGAAAATTAGAAAAAAATTCTTTAATCAATAAGTTCT
ACTTACATTACTAAATACACAGAATTACTTCTCAAATGCATAATTAAAGACATCCAGTAT
TATTATGGGTATAATTTTCGGGTTCTCAAAATTTTTTAAATCGAATTTGCTAAAAACTCT
GACTTCAGAATTCCTCATATTTGGTGGAGCGCATTTTAAGATAGATATAGGATGCTAATT
GAATTTAAGAGAAATGAACATGAAAAAAAAAAAAAATTTAAACTAAATGTTTTTAAGAAC
AATTATTTTCTCTGTCCTATTTGCATTCAGTATAACTGTATGATCCACAAAAGCTGTAAC
GATATCCACTATCTTAAAAATGATAATTGGACACCACTCTTTGATAAAAACATTCCAAAA
CACTAATTGCATATTGATAAAATCAAAGATTTTTTAACAATGTATAATGGAACTAATTAT
GCACATAAATTTATGTGTAAAGATCATGAATTTTGTTTTAGGAATCAACTGAATAAAAAT
AAATAAGATTTGATTTCAGTATAATAGCATAAATTTAATTGCCTGAATAAAAGGTGGATA
AACATGCTTCTTTACTTTGCAGATTGCTTTACATTTTAAAATCCTTGCTTTTTGACTATC
ATCATTAACATGAGCACTTCTAATGATGATCTCAAATTTTAGTGTAAGGATATTTATCAG
TACTTAAAAAGTGTTAGACCTCAATATTACAGCTTAGAAAGAATACAAAATGAGATAAAT
GCCTTTATTTAATCTAGAGAAAAGGAGTATTTAAAATTGTTAAGCAAAGACTCAGAAAAT
ATTTTGGATGACAAATATATTTAAAAACACTTCTATCATATCCCTGACTAGAAATAAGAA
ATATTGAATTAATTGAAAGAGTTAAGCGAGATGCTCAAATGCAATTACACTCCTTGCTTT
CATACAGGTGTGTGTGATGGAGAAAATGGATGCCGTTGCTATAGAAATAGAGATCTTATT
GAAAAAATGTAAAAGAGAATTGATAAGTTAAAACATATTTAAAAGAAAGAAAAAAAGCAC
ACAAAGAAGGTATTAGAGCTTTCTTTTGACAATAATTCTATAGATAGTAATGAAGAAGAT
GATGATGAGGAATCTAGTGATCTTTAATATATGACTTATTAAGAGATTATTAGCAAATTT
TTGCATGAATGTGAAAGATTTTGTGGATGCCCTAATTACTGTAGATCAAAAAATAAGAAA
TTAGGTTGTAATTGCTTAAATGATATGACATGCCAAACTGATAAAAATTGCTAATGCAGA
AGTAAATTGAGAGAGTGCGACCCAGAAGTTTGTAGATGCTTCTGTAATAGGAATGCAAGA
ACAATATAAAAATTTGGACTCAATATTGATTACTGCACTAATTCTTAAGCCCTTTATAAC
TGTAAACCGCGAGTGCTTCTTGGTAAAAGTCTTGTTTGTGAAGGTCTGGGTCTTTTTGCT
GGATAGGATTTTAAAAAGAACTAGTATATTGGATGCTATATAGGAGAGATCATAAATGAA
AAATAAGGAACAGAAAGACAAGAAGTCTAACAGCCTTAAGGGATTAGTTATTTATTTATG
CTTAATAAGGAGACAGATGTGGACAGTTTTAGATATGGAAATAAAATGAGATATGTAAAT
CATAATTGTGGTAGTATGGCGAATTGCAAAGTTGATGTCATTTATAACAGAGGCATCAAT
ATAGTTAGATTCAGTGCTAAGGAAGATATTTAAAAAGGACAAGAAATATATTTCGATTAT
AATAGAAATTATCAAATTGAATGGATGAAATATTTTAACGAGTACTATGATAAGTTTGAA
TAAGAAGAAAAGAAATAGCAAGTCTAAAAAAAAATAATATCTAAATTTATAAAGAACTGA


>TTHERM_00335780(protein)
MDPKFEIQLRAQEQDLQEQNFFNLDINDQQKIKEGMVKVIASAYIRFKMAFRACCWKGYS
DNDIYIQQNLQKGIAEHQNKVKRIKKKVQNFFQSEMSIEPHQFVVQILKNRDQVYSGGIF
QHVNSYVQINESIKDEKTKYLYRDVENIGLKKSDQVNHQESQQAKQLKENQKKILQSISS
TYITKYTELLLKCIIKDIQYYYGYNFRVLKIFQIEFAKNSDFRIPHIWWSAFQDRYRMLI
EFKRNEHEKKKKFKLNVFKNNYFLCPICIQYNCMIHKSCNDIHYLKNDNWTPLFDKNIPK
HQLHIDKIKDFLTMYNGTNYAHKFMCKDHEFCFRNQLNKNKQDLISVQQHKFNCLNKRWI
NMLLYFADCFTFQNPCFLTIIINMSTSNDDLKFQCKDIYQYLKSVRPQYYSLERIQNEIN
AFIQSREKEYLKLLSKDSENILDDKYIQKHFYHIPDQKQEILNQLKELSEMLKCNYTPCF
HTGVCDGENGCRCYRNRDLIEKMQKRIDKLKHIQKKEKKHTKKVLELSFDNNSIDSNEED
DDEESSDLQYMTYQEIISKFLHECERFCGCPNYCRSKNKKLGCNCLNDMTCQTDKNCQCR
SKLRECDPEVCRCFCNRNARTIQKFGLNIDYCTNSQALYNCKPRVLLGKSLVCEGLGLFA
GQDFKKNQYIGCYIGEIINEKQGTERQEVQQPQGISYLFMLNKETDVDSFRYGNKMRYVN
HNCGSMANCKVDVIYNRGINIVRFSAKEDIQKGQEIYFDYNRNYQIEWMKYFNEYYDKFE
QEEKKQQVQKKIISKFIKN


>TTHERM_00335780(gene)
ATGGATCCAAAATTTGAAATATAGCTCAGAGCTTAAGAGTAAGATTTATAGGAATAAAAT
TTCTTCAATTTGGATATAAATGATCAATAGAAAATTAAGGAAGGGATGGTAAAGGTTATT
GCTTCTGCATATATTAGGTTTAAAATGGCTTTTAGAGCTTGTTGCTGGAAAGGGTACAGC
GATAATGATATCTATATTTAATAGAATTTACAAAAAGGCATCGCTGAACACTAAAATAAA
GTAAAAAGAATAAAAAAAAAGGTATAGAATTTTTTTCAGTCTGAGATGTCTATTGAGCCT
CACTAATTTGTGGTTTAAATACTTAAAAACAGAGATTAAGTTTATTCAGGTGGTATTTTC
TAACATGTAAACTCATATGTGCAAATAAACGAATCTATAAAAGATGAAAAAACAAAATAT
CTCTACAGAGATGTTGAAAATATAGGTTTGAAAAAATCTGACCAAGTAAATCACTAAGAG
AGTTAGCAAGCTAAGCAATTAAAAGGTTAGCTTACTTTTTTGGAAAAAAAAAATTAATTT
GTTTTTATTTAATCAAAAAAAAGAAAATTAGAAAAAAATTCTTTAATCAATAAGTTCTAC
TTACATTACTAAATACACAGAATTACTTCTCAAATGCATAATTAAAGACATCCAGTATTA
TTATGGGTATAATTTTCGGGTTCTCAAAATTTTTTAAATCGAATTTGCTAAAAACTCTGA
CTTCAGAATTCCTCATATTTGGTGGAGCGCATTTTAAGATAGATATAGGATGCTAATTGA
ATTTAAGAGAAATGAACATGAAAAAAAAAAAAAATTTAAACTAAATGTTTTTAAGAACAA
TTATTTTCTCTGTCCTATTTGCATTCAGTATAACTGTATGATCCACAAAAGCTGTAACGA
TATCCACTATCTTAAAAATGATAATTGGACACCACTCTTTGATAAAAACATTCCAAAACA
CTAATTGCATATTGATAAAATCAAAGATTTTTTAACAATGTATAATGGAACTAATTATGC
ACATAAATTTATGTGTAAAGATCATGAATTTTGTTTTAGGAATCAACTGAATAAAAATAA
ATAAGATTTGATTTCAGTATAATAGCATAAATTTAATTGCCTGAATAAAAGGTGGATAAA
CATGCTTCTTTACTTTGCAGATTGCTTTACATTTTAAAATCCTTGCTTTTTGACTATCAT
CATTAACATGAGCACTTCTAATGATGTAATTATTATTTTTATACCACTTATATTTATTAA
TTAAGTGAATATTTTTCAATTAGGATCTCAAATTTTAGTGTAAGGATATTTATCAGTACT
TAAAAAGTGTTAGACCTCAATATTACAGCTTAGAAAGAATACAAAATGAGATAAATGCCT
TTATTTAATCTAGAGAAAAGGAGTATTTAAAATTGTTAAGCAAAGACTCAGAAAATATTT
TGGATGACAAATATATTTAAAAACACTTCTATCATATCCCTGACTAGAAATAAGAAATAT
TGAATTAATTGAAAGAGTTAAGCGAGATGCTCAAATGCAATTACACTCCTTGCTTTCATA
CAGGTGTGTGTGATGGAGAAAATGGATGCCGTTGCTATAGAAATAGAGATCTTATTGAAA
AAATGTAAAAGAGAATTGATAAGTTAAAACATATTTAAAAGAAAGAAAAAAAGCACACAA
AGAAGGTATTAGAGCTTTCTTTTGACAATAATTCTATAGATAGTAATGAAGAAGATGATG
ATGAGGAATCTAGTGATCTTTAATATATGACTTATTAAGAGATTATTAGCAAATTTTTGC
ATGAATGTGAAAGATTTTGTGGATGCCCTAATTACTGTAGATCAAAAAATAAGTAAAAAT
TTTTTAAATATTTGAAATAAAATACTTAAATTCATTCTTAGGAAATTAGGTTGTAATTGC
TTAAATGATATGACATGCCAAACTGATAAAAATTGCTAATGCAGAAGTAAATTGAGAGAG
TGCGACCCAGAAGTTTGTAGATGCTTCTGTAATAGGAATGCAAGAACAATATAAAAATTT
GGACTCAATATTGATTACTGCACTAATTCTTAAGCCCTTTATAACTGTAAACCGCGAGTG
CTTCTTGGTAAAAGTCTTGTTTGTGAAGGTCTGGGTCTTTTTGCTGGATAGGATTTTAAA
AAGAACTAGTATATTGGATGCTATATAGGAGAGATCATAAATGAAAAATAAGGAACAGAA
AGACAAGAAGTCTAACAGTAACTATTATTTATTAAAAATAAATAAATAATTTTAATTTTA
TTTATTATTTACTAGGCCTTAAGGGATTAGTTATTTATTTATGCTTAATAAGGAGACAGA
TGTGGACAGTTTTAGATATGGAAATAAAATGAGATATGTAAATCATAATTGTGGTAGTAT
GGCGAATTGCAAAGTTGATGTCATTTATAACAGAGGCATCAATATAGTTAGATTCAGTGC
TAAGGAAGATATTTAAAAAGGACAAGAAATATATTTCGATTATAATAGAAATTATCAAAT
TGAATGGATGAAATATTTTAACGAGTACTATGATAAGTTTGAATAAGAAGAAAAGAAATA
GCAAGTCTAAAAAAAAATAATATCTAAATTTATAAAGAACTGA