Identifiers and Description

Gene Model Identifier

TTHERM_01179960

Standard Name

EXO1 (Homolog of budding yeast, fission yeast and mouse EXO1)

Aliases

PreTt04565 | 265.m00045

Description

XPG I-region family protein Protein involved in DSB repair

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01179960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20915.19.997093137033517e-262XPG I-region family protein (8
81 aa)
OxytrichaContig18799.0.g411.0001267035975107e-72XPG I-region
DictyBaseDDB_G02915701.0004460510701209e-64exo1 on chromosome: 6 position
561048 to 564580
SGDYOR033C6.001055639413166e-58EXO1 5-3 exonuclease and flap-
endonuclease involved in recom
bination, double-strand break
repair and DNA mismatch repair
; member of the Rad2p nuclease
family, with conserved N and
I nuclease domains
WormBaseWBGene000097311.0002335610448659e-38locus:exo-1 status:Confirmed
UniProt:O62245 protein_id
:CAB07612.2
Stentor CoeruleusSteCoe_330405.380186160021138e-32

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26519827: Lukaszewicz A, Shodhan A, Loidl J (2015) Exo1 and Mre11 execute meiotic DSB end resection in the protist Tetrahymena. DNA repair 35( ):137-43

Sequences

>TTHERM_01179960(coding)
ATGGGTATTACTGGATTATTAAACCTGCTGAAAAGTATAGTAGTAAAAAGACATTTAAAA
GAATACAAAGACAAAACTGTGGCTATTGATGCTTATACATGGCTTCATCCTGCTATTTAT
ACTTGCTCTTATGAATTAGCTAACAATATAGAGACGACCAAACATATTGAATTTTGCACA
AAAAGAATTGATTAAATATTGAGTTTTGGGATTAAGAAAATTGTTTTAGTATTTGATGGA
AGACAATTACCAGGTAAAAAGGGAACAGAAGAAAAGAGAGAAAAATCAAGAGAAGACAGC
AGAAATGAGGCTTAGCTTCTACTTGCTCAAGATAAAAAAGATTAAGCTTATAAAAAATTC
GCTAGCTCTATTGATATCACTCCTTAAATGGCATTTGAACTTATTAAAGCAGTAGAAGGC
AGACCGAATGTAGAGTGTATAGTTGCTCCATATGAAGCAGATGCTTAACTGGCATACCTC
AGCTAGATTGATTATGTTGATGTTGTGTTTAGTGAAGATTCAGATCTTTTAGCATTCGGA
TGCAAGAAAGTATTATTTAAACTTTATAAAGGTGATAACAAAGAAACAGGAGATGAAATA
TCTTTAGACAATATTAAAAATTGTAAAGAAATAAACATGAGTTTGTGGAATCACAACATG
TTCTTAACTGCTTGTATATTCTCAGGATGTGACTATCTTCCTTCTTTAAAAAAAATGGGA
ATTTAAACAGCTTTTAAGTTGGTTGGAGAGTTCAAATAATTCAAAAAATGTATGCTTTCT
ATTTAACAAAAAAATTATGATGTTCCAGTAGATTACGATGAGAAGTTTTAGCTAGCATTC
TTAACTTTCCGCTTCTAATATGTATACTGTCCTATCAAAGAAGAGATTAGGACATTAAAT
ACTTATAATTCGAATGACCTTAGACTTTAATTCGTAGAGTTAGATTTCCATAATTAAGTT
AGCTAAACAAATTGGACTCACTTTGAGGATAACATACTTATTAGACCTTTGATTTATAAA
ATTTTGGAGCCAAATTTCAGCTGGTCTTTCTTAGGAGACATGGACTTGAGTGTAGCATTA
CAGGTTTCAAAGTATATGATAGATCCAGAAACTTTAATGCCTTATAAAGAAGTAAAAAGT
AAGCTTTTTGGAATAGATAATAGTAAAGGCAATCAAGTTAAGCTCGGAACAGGTGGTCTC
TAATCACTATAAAACAATCAGAAACTTTAAAAGAGACAACAAACTTCTCTATCAGATTCA
GCTACTTCCACCAAATAAACTCAATTAAACGCCTTCTTAAAAGTTGGAACTAAAAATAGT
GTCAACAAATCAAGTTCTGTAGATCAAAAATAAGGTTCTGAAAGAAATTTTTTCTTATTG
GAAGACGCAAACAGTAACTCACTGAACTTCAATAGGAGTAAAATGAGTGATAAAAATGTA
GATTCACAAGAATTATCCCTTACCAATAATGATATTTTTAGCAAAAATATTTTTAATAAA
AATTCTAATGTTGTAAAACCTTTTAAACCTCCTTCAAATTCGAATTCTCAGAACACTCAG
TCAAGCAATATTTTAAAGAAAAAAAGTGAATATAAAAGACCATACTATGAGTACTATGAG
GAAAGTAACTATTTCTCTGATGAAGATGATCTCAATTTCTTAACAGTAGGGAAAATATAA
GAACAGTAGTAAGAGGACACTAACTCAAATAGAAAAGAAAATACTTCGAGTGATAATAAT
AAATAAATAAAGAATAATAACTAAAAATCTGAATTAGATTCTGATAATAATTAACAGATT
TACGAAGAAGAAAATAATTTTGAAAACAATAACGATTTATTGAATTTAAATTAATTTAAA
TCAAACAAATTAATTGTAAATAACTTACAAAAGTAAACTTCTCTCTCGGGATTACAAAAG
TAGTAAAATAGCTTAACAAATAAATAATATAATAAGCTTATCATTGACAAAACACCAATT
AATTAAATTGATATTCCTAAAAAAAATATTTCTTAAAATTTCGAAATAAGATAAATATAG
AAAATAGCAAGAAATGACATAGAAGTTGAAAGTGAAGATGAAGAAAAATTAGTAAACTAA
ATTAATTCTGAAGATAATCCAATGTTAAACTAAAATAATTATTATTAAAAATCAAGACAA
TTTATCAAAAAAACGATTAACAACAAAGAAAATGATAGCCAAGAAGATAATAAATCATGC
ATTTCAACTCAATCATAAAAAAATTTGATAAGCTAAGACGTTGGAGGCATACAAAATAGT
GAAAAATATTAATCATAAAAATGTACTCAAAAAACCATCTCAGAAGAATTATCTTGTTAA
GGTAGTAATGATCAGCAAGGAGAAAATACCATATTATCTAGAATGAATAATTTTACTAAA
GAGACTGATGGCTAGTTAGTTATAGATTCATAATATTTAATTCAAAGACATCCTGAATAT
AATTTTTTAGAGAAGTTTTCAATGTTCTTTAAGAATGAAGTGAACATTTGA


>TTHERM_01179960(protein)
MGITGLLNLLKSIVVKRHLKEYKDKTVAIDAYTWLHPAIYTCSYELANNIETTKHIEFCT
KRIDQILSFGIKKIVLVFDGRQLPGKKGTEEKREKSREDSRNEAQLLLAQDKKDQAYKKF
ASSIDITPQMAFELIKAVEGRPNVECIVAPYEADAQLAYLSQIDYVDVVFSEDSDLLAFG
CKKVLFKLYKGDNKETGDEISLDNIKNCKEINMSLWNHNMFLTACIFSGCDYLPSLKKMG
IQTAFKLVGEFKQFKKCMLSIQQKNYDVPVDYDEKFQLAFLTFRFQYVYCPIKEEIRTLN
TYNSNDLRLQFVELDFHNQVSQTNWTHFEDNILIRPLIYKILEPNFSWSFLGDMDLSVAL
QVSKYMIDPETLMPYKEVKSKLFGIDNSKGNQVKLGTGGLQSLQNNQKLQKRQQTSLSDS
ATSTKQTQLNAFLKVGTKNSVNKSSSVDQKQGSERNFFLLEDANSNSLNFNRSKMSDKNV
DSQELSLTNNDIFSKNIFNKNSNVVKPFKPPSNSNSQNTQSSNILKKKSEYKRPYYEYYE
ESNYFSDEDDLNFLTVGKIQEQQQEDTNSNRKENTSSDNNKQIKNNNQKSELDSDNNQQI
YEEENNFENNNDLLNLNQFKSNKLIVNNLQKQTSLSGLQKQQNSLTNKQYNKLIIDKTPI
NQIDIPKKNISQNFEIRQIQKIARNDIEVESEDEEKLVNQINSEDNPMLNQNNYYQKSRQ
FIKKTINNKENDSQEDNKSCISTQSQKNLISQDVGGIQNSEKYQSQKCTQKTISEELSCQ
GSNDQQGENTILSRMNNFTKETDGQLVIDSQYLIQRHPEYNFLEKFSMFFKNEVNI


>TTHERM_01179960(gene)
ATGGGTATTACTGGATTATTAAACCTGCTGAAAAGTATAGTAGTAAAAAGACATTTAAAA
GAATACAAAGACAAAACTGTGGCTATTGATGCTTATACATGGTATCATTCATTATTACTT
TCTTCACTCTTGAATAAGTTGCTCTTTTTAGGCAAAAATAACTTTGTTAATTGAATAAAA
TAGGCTTCATCCTGCTATTTATACTTGCTCTTATGAATTAGCTAACAATATAGAGACGAC
CAAGTAATTATTTTATTTTTTTATGAAAATGAAAAGTAAAATTATTTTTCTGTAATTAGA
CATATTGAATTTTGCACAAAAAGAATTGATTAAATATTGAGTTTTGGGATTAAGAAAATT
GTTTTAGTATTTGATGGAAGACAATTACCAGGTAAAAAGGGAACAGAAGAAAAGAGAGAA
AAGTAATTTATTTATTTTTAGTTTTGAATACACCATTTATTTAACTATGTTATTGAGATA
AAAGTGTTTTAATTAAAAGACCTTTTACTACAGTGATTTCTAATTGTTGATATATTAATA
TTTATATATCAAAAATATTTAATTTATTGTGTGTATAGCATATTAATATTACTTTATAAT
ATATAGATCAAGAGAAGACAGCAGAAATGAGGCTTAGCTTCTACTTGCTCAAGATAAAAA
AGATTAAGCTTATAAAAAATTCGCTAGCTCTATTGATATCACTCCTTAAATGGCATTTGA
ACTTATTAAAGTATTTATTTATAAAAGCATATTCTTTTATTTAATTTCTACTAAATAAAA
AAGGCAGTAGAAGGCAGACCGAATGTAGAGTGTATAGTTGCTCCATATGAAGCAGATGCT
TAACTGGCATACCTCAGCTAGATTGATTATGTTGATGTTGTGTTTAGTGAAGATTCAGAT
CTTTTAGCATTCGGATGCAAGAAAGTATTATTTAAAGTATGAAATTTATTTACTTATTTA
CTACTATTTTGCATTTGTCTAAATATTATATAATTATAATATTTAAGGAATAATAAATAT
ATATATAAATTAGCTTTATAAAGGTGATAACAAAGAAACAGGAGATGAAATATCTTTAGA
CAATATTAAAAATTGTAAAGAAATAAACATGAGTTTGTGGAATCACAACATGTTCTTAAC
TGCTTGTATATTCTCAGGATGTGACTATCTTCCTTCTTTAAAAAAAGTAATAAATAATAA
TAATAATATAAAATTATTACAAATATATAATTGTTATTTTTGTTAAAGTTAGTTAATTAA
TTTTTCAATATTTATATCTTATGTTTGTTTTTTATATTAAATAAGATGGGAATTTAAACA
GCTTTTAAGTTGGTTGGAGAGTTCAAATAATTCAAAAAATGTATGCTTTCTATTTAACAA
AAAAATTATGATGTTCCAGTAGATTACGATGAGAAGTTTTAGCTAGCATTCTTAACTTTC
CGCTTCTAATATGTATACTGTCCTATCAAAGAAGAGATTAGGACATTAAATACTTATAAT
TCGAATGACCTTAGACTTTAATTCGTAGAGTTAGATTTCCATAATTAAGTTAGCTAAACA
AATTGGACTCACTTTGAGGATAACATACTTATTAGACCTTTGATTTATAAAATTTTGGAG
CCAAATTTCAGCTGGTCTTTCTTAGGAGAGTAAGGAAACATAAAAATTAGTGCATTTTAA
TTGACTAAATGTATTTTATATTTATTTATTTAGCATGGACTTGAGTGTAGCATTACAGGT
TTCAAAGTATATGATAGATCCAGAAACTTTAATGCCTTATAAAGAAGTAAAAAGTAAGCT
TTTTGGAATAGATAATAGTAAAGGCAATCAAGTTAAGCTCGGAACAGGTGGTCTCTAATC
ACTATAAAACAATCAGAAACTTTAAAAGAGACAACAAACTTCTCTATCAGATTCAGCTAC
TTCCAGTATAAAATATTTGAAATTTTTTTAATCAATAGTTTAAAATTATACTTAAAAATA
GCCAAATAAACTCAATTAAACGCCTTCTTAAAAGTTGGAACTAAAAATAGTGTCAACAAA
TCAAGTTCTGTAGATCAAAAATAAGGTTCTGAAAGAAATTTTTTCTTATTGGAAGACGCA
AACAGTAACTCACTGAACTTCAATAGGAGTAAAATGAGTGATAAAAATGTAGATTCACAA
GAATTATCCCTTACCAATAATGATATTTTTAGCAAAAATATTTTTAATAAAAATTCTAAT
GTTGTAAAACCTTTTAAACCTCCTTCAAATTCGAATTCTCAGAACACTCAGTCAAGCAAT
ATTTTAAAGAAAGTAAATTTTATTAGAAAACCATTCAATTTTTTCAATTTTTTTAAAAGA
AAAGTGAATATAAAAGACCATACTATGAGTACTATGAGGAAAGTAACTATTTCTCTGATG
AAGATGATCTCAATTTCTTAACAGTAGGGAAAATATAAGAACAGTAGTAAGAGGACACTA
ACTCAAATAGAAAAGAAAATACTTCGAGTGATAATAATAAATAAATAAAGAATAATAACT
AAAAATCTGAATTAGATTCTGATAATAATTAACAGATTTACGAAGAAGAAAATAATTTTG
AAAACAATAACGATTTATTGAATTTAAATTAATTTAAATCAAACAAATTAATTGTAAATA
ACTTACAAAAGTAAACTTCTCTCTCGGGATTACAAAAGTAGTAAAATAGCTTAACAAATA
AATAATATAATAAGCTTATCATTGACAAAACACCAATTAATTAAATTGATATTCCTAAAA
AAAATATTTCTTAAAATTTCGAAATAAGATAAATATAGAAAATAGCAAGAAATGACATAG
AAGTTGAAAGTGAAGATGAAGAAAAATTAGTAAACTAAATTAATTCTGAAGATAATCCAA
TGTTAAACTAAAATAATTATTATTAAAAATCAAGACAATTTATCAAAAAAACGATTAACA
ACAAAGAAAATGATAGCCAAGAAGATAATAAATCATGCATTTCAACTCAATCATAAAAAA
ATTTGATAAGCTAAGACGTTGGAGGCATACAAAATAGTGAAAAATATTAATCATAAAAAT
GTACTCAAAAAACCATCTCAGAAGAATTATCTTGTTAAGGTAGTAATGATCAGCAAGGAG
AAAATACCATATTATCTAGAATGAATAATTTTACTAAAGAGACTGATGGCTAGTTAGTTA
TAGATTCATAATATTTAATTCAAAGACATCCTGAATATAATTTTTTAGAGAAGTTTTCAA
TGTTCTTTAAGAATGAAGTGAACATTTGA