Identifiers and Description

Gene Model Identifier

TTHERM_00118700

Standard Name

ETU1 (Epsilon-TUbulin)

Aliases

PreTt27186 | 8.m00446 | 3812.m02478

Description

Tubulin/FtsZ family, GTPase domain containing protein, Epsilon-tubulin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00118700

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_3750
Tetrahymena borealisEI9_03868.19.997093137033517e-262tubulin/FtsZ family, GTPase do
main-containing protein (481 a
a)
OxytrichaContig18792.0.g346.001815994751712e-130Tubulin/FtsZ family, GTPase do
main
WormBaseWBGene000065381.999469658314961e-75locus:tbb-4 Tubulin beta-4 c
hain status:Partially_confir
med UniProt:P41937 protein
_id:CAA86310.1
SGDYML124C3.000809166761476e-75TUB3 Alpha-tubulin; associates
with beta-tubulin (Tub2p) to
form tubulin dimer, which poly
merizes to form microtubules;
expressed at lower level than
Tub1p
DictyBaseDDB_G02691962.9990539278805726e-74tubB on chromosome: 1 position
3261649 to 3263130

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00118700(coding)
ATGAGAGAACTTATAACTATTTAAGTAGGTCAGTGTGGAAACTAAATTGGTGCTAAATTC
TGGGAATTAGCGATAAAAGAACACTCAAAATATAATAAATCTTCTGTCTATGATGATGCT
CTTTCTTCTTTTTTCCGTAATATAGATAAGAGCTCTAAAGGACATGAATTAAAAGTTGGC
AGTGAAATAATCAACTTGAAGGCAAGATCTATAATAGTTGATATGGAAGAGGGTGTCACA
AATCAACTTTTAAAGAGTGATATTGGAGATCTTTTTGATTAGAGATAGTTCATAAATGAT
GTGAGTGGTGCAGGAAATAATTGGGCTCATGGTCACTTTTTCTATGGAAATAAGTATAGA
GATAATATGAGTGAAAGAATCAGGAAAGCTGTAGAATAATGTGATTCTTTGTAATGTTTT
TTCTTGATGCATTCTTTAGGAGGAGGAACAGGATCAGGATTAGGAACATTCCTACTCTCA
TTAATTGAAGATGAATATCCCGATGTTTATAGATTTACAGCTTCTGTATTTCCTCAAAAG
GATGATGATGTTATAACCTCACCTTATAATAGCTTTTTTTCTTTGTATGAGCTAGCTAAG
CATGCCGATTGTGTGTTTCCTATTGATAATTAAGCTTTAATGAATATTTGCTACTAAATT
GATAATCCAAACAAGGTAAAGTTGGCAAAGGATAATATAAATGTAAGCAAAGAAGAAGAA
ATAAAAATAATGATGAACAAAGGTTCTAAGATAACTTAAGCAGGAACTGAAGAAAAGAAA
GAAAAGCCTTTTGATAAAATGAATAATATTATTGCACATTTACTCAGTAATATTACATGC
TCTATGAGATTTGAGGGAGTTCTAAATGTTGATCTTAATGAAATAACAATGAATTTAGTT
CCTTATCCTGATTTACATTTCTTAATATCAAGTATAGCTCCGCTTTATTCCTTATCGGAT
AGCAACTTATAGCCTAGAAGATTAGATTAAATGTTTAAAGACTGCTATCATCCTGATTAT
TAGCTAGTTAGTGTGAATCCCTTTTAAAATAAGTATTTAGCAGTAGGATTAATGGTAAGG
GGATCAGTTCCCTTTTCTGATGTAAATAGAAATATCAAAAAGCTTAGAAGTGAGTTAAAT
ATGATTTACTGGAACCAAGAAGGTTTTAAGTACGGTATATGCAACACACCTCCTATAGGC
CAACCTTACTCCTTGCTATGCTTGGCAAATAATACTGCAATAAGAGATCAGTTTTCGACT
ATGGTAGAGAGATTCAACAAACTATATAAAAGGAAGGTGTTTGTTCATCATTATACAGAA
TATATGGATGCAAAGCATTTTGACGAGGCTTTGAATTCTATCACATCTCTTATAAGTAAA
TATGAAGAACTCCATAAAGCTGAAGAACCTTCTTCTCAACCAAGATTGAAACCTTTGATT
TGA


>TTHERM_00118700(protein)
MRELITIQVGQCGNQIGAKFWELAIKEHSKYNKSSVYDDALSSFFRNIDKSSKGHELKVG
SEIINLKARSIIVDMEEGVTNQLLKSDIGDLFDQRQFINDVSGAGNNWAHGHFFYGNKYR
DNMSERIRKAVEQCDSLQCFFLMHSLGGGTGSGLGTFLLSLIEDEYPDVYRFTASVFPQK
DDDVITSPYNSFFSLYELAKHADCVFPIDNQALMNICYQIDNPNKVKLAKDNINVSKEEE
IKIMMNKGSKITQAGTEEKKEKPFDKMNNIIAHLLSNITCSMRFEGVLNVDLNEITMNLV
PYPDLHFLISSIAPLYSLSDSNLQPRRLDQMFKDCYHPDYQLVSVNPFQNKYLAVGLMVR
GSVPFSDVNRNIKKLRSELNMIYWNQEGFKYGICNTPPIGQPYSLLCLANNTAIRDQFST
MVERFNKLYKRKVFVHHYTEYMDAKHFDEALNSITSLISKYEELHKAEEPSSQPRLKPLI


>TTHERM_00118700(gene)
ATGAGAGAACTTATAACTATTTAAGTAGGTCAGTGTGGAAACTAAATTGGTGCTAAATTC
TGGGAATTAGCGATAAAAGAACACTCAAAATATAATAAATCTTCTGTCTATGATGATGCT
CTTTCTTCTTTTTTCCGTAATATAGATAAGAGGTATTTTTGAATTGATCAATTGTATTAA
TCACTATATAATTTATGATTCATAATAGCTCTAAAGGACATGAATTAAAAGTTGGCAGTG
AAATAATCAACTTGAAGGCAAGAGTAAATAAATAAATTATAGAAAAATATAATTAATTTA
ATAACAATTCAGTCTATAATAGTTGATATGGAAGAGGGTGTCACAAATCAACTTTTAAAG
AGTGGTAAAAAATGAATACAAAATCAAACAATTCAATTTATTAGAAAATTGTTCTAACTA
AGACTTTCTATTTATTTAAATAAGATATTGGAGATCTTTTTGATTAGAGATAGTTCATAA
ATGATGTGAGTGGTGCAGGAAATAATTGGTACATTCAAATATAGCTCTATATATTAAATA
ATTTAATTTTATTAAATAAGGGCTCATGGTCACTTTTTCTATGGAAATAAGTATAGAGAT
AATATGAGTGAAAGAGTAAATAAATACTTTTTAAAAAACTTTAAAATTCAAAAGTAGTTT
TTTATATGAAATTATAAATAATAATAAACAGATCAGGAAAGCTGTAGAATAATGTGATTC
TTTGTAATGTTTTTTCTTGATGCATTCTTTAGGAGGAGGAACAGGATCAGGATTAGGAAC
ATTCCTACTCTCATGTATATATATACTTTTAAAAGTACTTTAAAATAATAGATTCATATA
AATTAAAAAGTAATTGAAGATGAATATCCCGATGTTTATAGATTTACAGCTTCTGTATTT
CCTCAAAAGGATGATGATGTTATAACCTCACCTTATAATAGGTAATAATGCATATTTAAT
AGAATTAATAATAATATGTTTTTTTGCTATTTAAATTTAACTTTATTAGAGAATAATAAA
TTACACAAATATTTTATCTGATTATGTTTATAAAAAAATAAGCTTTTTTTCTTTGTATGA
GCTAGCTAAGCATGCCGATTGTGTGTTTCCTATTGATAATTAAGCTTTAATGAATATTTG
CTACTAAATTGATAATCCAAACAAGGTAAAGTTGGCAAAGGATAATATAAATGTAAGCAA
AGAAGAAGAAATAAAAATAATGATGAACAAAGGTTCTAAGATAACTTAAGCAGGAACTGA
AGAAAAGAAAGAAAAGCCTTTTGATAAAATGAATAATATTATTGCACATTTACTCAGTAA
TATTACATGGTAAATTTATTTGAGAAAATGGCTCATAAAAATTAATTTGAATTTAAATTA
AAGCTCTATGAGATTTGAGGGAGTTCTAAATGTTGATCTTAATGAAATAACAATGAATTT
AGTTCCTTATCCTGATTTACATTTCTTAATATCAAGTATAGCTCCGCTTTATTCCTTATC
GGATAGCAACTTATAGCCTAGAAGATTAGATTAAATGTTTAAAGACTGCTATCATCCTGA
TTATTAGCTAGTTAGTGTGAATCCCTTTTAAAATAAGTATTTAGCAGTAGGATTAATGGT
AAGGGGATCAGTTCCCTTTTCTGATGTAAATAGAAATATCAAAAAGCTTAGAAGTGAGTT
AAATATGATTTACTGGAACCAAGAAGGTTTTAAGTACGGTATATGCAACACACCTCCTAT
AGGCCAAGTAATTAAATTTTTTTTAATTAAATTATTTATTTTAAAAAAATATAAAAAAAG
CCTTACTCCTTGCTATGCTTGGCAAATAATACTGCAATAAGAGATCAGTTTTCGACTATG
GTAGAGAGATTCAACAAACTATATAAAAGGAAGGTAAAAATTTAATAAAGGAATTATCAA
TTTAACAATTTTATTTTTAGGTGTTTGTTCATCATTATACAGAATATATGGATGCAAAGC
ATTTTGACGAGGCTTTGAATTCTATCACATCTCTTATAAGTAAATATGAAGAACTCCATA
AAGCTGAAGAACCTTCTTCTCAACCAAGATTGAAACCTTTGATTTGA