Identifiers and Description

Gene Model Identifier

TTHERM_00266660

Standard Name

ETA1 (ETA-tubulin)

Aliases

PreTt09801 | 24.m00232 | 3690.m00047

Description

Eta-tubulin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 36.6%

TetraMine Data

TTHERM_00266660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10015.19.997093137033517e-262hypothetical protein (1572 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00266660(coding)
ATGAATATTTCTTTTTTTAGTACACTCTCTTCAAAATTATTTTTAGGAATCGCTATTTTA
TGGATAAATATTAAGTTTCTTAAAGCTGCAAACTATCCTCAATTAGTCTTTTCTCCTTCT
TCCTTGTAGCAGTATGACCTTCGTAGCTAAGGTGGTTATTCAGCTAAGCTTGCCTATGCT
TAAAATGCTAGTCTAGTTTTTGCAGCAACAGGATCATTGGGAGTATCAGTTTTAGATTCA
AAAACATATCAGATAATTAGCTAAATTAACTTGAATAATCAAACCATAACTGGTTTAGAT
GTTACTTCAGATGGTGAATATGTAATGATGGGATATTAAAATAAATTTTCAGTCTTCAAG
TATTCAAATAAAAATCTTACTCTTTTATCATAAGCCTCATTCTAATCAGGAGTAATCATG
GATGTAAGTTTAGACCAAACTGAAACTATAGCTTTTGGATATGGTATGCCAGGTTAAATC
TGTGCTTACAATATTTTGAATAAAAATAATATTGTCTTTTTAACTAAATTTAACACTGCT
TCTAATAGAGTAAGATAACTTTACGCGACTTTAGATAACAAATATCTCCTTCTTGCAGAT
AGCACAAGCGGGTTAAATGTTATTCAAGTTACGAATTCATAAGGAAATTACTAATTAAAA
AGCATTGCAGTTGGCACACCTGCGTGGGATGTGATGGATGTTAAATTTACTAATGATTAT
CAGATTGCTTATGTAGCAGATTTCTTTTATGGCCTGTTTTATATTAATCTTGGTTTCGTT
TTCAATTCAGATCCCAGTGCCTATCCTTTATAGCTAGGCAATTAGTTTATATCTTATTGG
CCTTTTTAGGTAGAGTCTGTAAACTCATTGGCTATTACTTCAAATAATAATTATCTACTT
GTTGGTTAAAGAGGTCTTGGCATTAAAATAATTGATATCTCTGACAAGAATAATCCAGCT
TACTATTCTGATATACCTGCTGTGGGTCATGCATTTACCATTTTGCTAGTCAACAATGAA
CAAAATATTTTTTTTGCAAACTCAATTAGCATTATAGTTTATGGCTAGTCAGTCCTAAAC
TTAAATGATTAATATCCTAACCTTTATAATGGATTTCAATCATTTATGTATTCACCATCT
AAAACACTTTACTACTGGAAGTGCATAATTGGTAAAAATGATACATATTTTTATGGAGTT
TTTGATGACGGAGGAGTTTATATTATGACTTATGGCGATGACCCTTACAATATGTAAATT
TTAGCATACATAATGTATAATCCAACAGACCAGACTGATTTTATGTGGATCAATGAAGAT
GAAACCTTGATGATATTGGGAATATCAACAAATTAATATACATTAGAAGTTTTTGATATC
ACTGATAAGACAAAACCAAAACTAATTACTTAAATAACTAAAACGGAATCTAATGACACA
GATGGTTGTGTATTTACTAAAGATATGACACGTTTTATTTGTGCTAATGGTGGAGATGGT
ATCTTTATAACAGATACAACAGATATAAAAAACTTAAAAATAATATTCACATGGCCTCTT
GAAAGTTTTATGACAGGAACCGTGAAAGATGTAGTTATAAAAGATAATAAATACATATTA
GGAGCTATAAGAAATTATGGAATGTGTGTCCTAGAATTAACAGATCCAAATACACTTGTT
CTTAGAGGTTATTTACAAACAAATGGTGGTGAAGGAATTGCTTTATCAAACGATTTAAAC
TACGTCTATCTCAAAGATGGTATTAATGGAGTAACAATAGTTGACATTTAGAATCTACCA
AATATTCATATTGTAGGCTAGGTTCAATTAGAAGGCTGGGAGGAAGGTATTGTTAGATTA
CAAAACGATAATTATTTAGTTGCATTAACTACAGATGCAGGCTATGCGGCTTTAATAGAT
TCTTCAAATAAAAGCACACCTTATGTTATAAGTAAATATAATCCAAATAAAGAGATTGCA
TACAATGGATGCACAGACAGCTAGGAAAACTATATAATGATTCTTACAAATGCTGGATTT
AGAGTGTTGCCAATTAAAACAAATTTGTATATACACACAGAAATAGACTTAGTTACAGGA
CAAAATTCTGGCTAGACAGTTTTAACTCCTCTCCCAAAATCTCAAAGTCTTTTAATAGGA
TAAACTATTCAGTTTACGTTCTTGATTCTTTATCCAGAAAAGAATATCAAAATAAATTAG
ATTCTTTACGTGGATAATTACGAGATAAAACAAATTCCCTACTGGATGACATATTCAAGC
AGTTCATAAATTCTAACAATGTCTATAGTAAAAGAGGCTCTAGGCTCTGGTAACATTTAG
AAAAGCTTAAATACTGTAATAATACAAACACTCAAGTAAATTTCATCAACTGATTTCATC
TACAACCAAACTAATGCTACTACAACAGCAGATCAGAGTATGATAATATATAAATATCTT
AGATAAATTTAATATATTGATAATAATGGATATATAACAACTTTATTTGATCCTGAAAGT
GATTTTTAATTCATTATTAGTGGATTGACTGTAACAGATAAATTGTAATAGCAAATCAAA
TTAACACTCGCCCGTAGCTTTTATCAGAATCCTGTAGTATTTTACATAGAGTCTTCTCTT
AAAATAAATTTTTAAAGCTCATCTGATTACATCACCTCTCAATCAAGTACCATAACTATT
TACTTTTTAATTGACTCTGCTTAAGGAAAATTTGTTTCCTTATCATATGGTGGTGTCATT
ACTTCAACAACAGAGAAACTTGAATAAATTAAGCTAGAAGGTTCTATTGAGAATATTAAT
AGAGCTCTTTAATTTGGAATATTTATATCAAGAATAGATTTAAATAATGATATAAATGTT
TAGGTCACTCTTTAAGATGGAACCAATTATGATTATTAGAAAACATTAAATTCAAAGGAT
ATATCTTTTATCCATACGATGGAGACCGTATAGATAGGTGAAACTTTATAATCCTAAATT
AATAATTGGTTTCCCGGAAGTATATTAGACATAGCTACTGCATTGAATTTTTAGTTTTCA
TCATCTAGCTTTTAGTGTGCATCCACAGTTACATTGTAATATTCTGCTTTCTTATAGAAA
GGAGGTTCTTATATTCCACTACCTAGTGATTTTTGGTTGTAGTTTGATAAAAATACAATC
AAATTTTATGGTTCCGCAACTACTTCACAATATGGATAGACATTTTACTTAAGAGTGAAT
GCTACTGATGGATATACCTATACATACTAAGATTTTTATATAATCATGAATGGTCTTCCT
TTCGTATACGTTTTTAATCTTTTGGTTTAAGTTTTCGGTCCAGTAATAGCTATTCTTGGA
GTTTTTTAATATAAATATCAAATCTTTAATGTGATTTTAAAAAAGTAAACAACTTACTCC
CCAGAAATAGCTTTAGTTAATAAATATTTTATAAAAACGTTTACTGTTGTTGGAAACGAT
CTTCTAAAGGCTAGATTAATATTTTAGATATTCAGAGAAAACGCAAATAGATTATCAAAT
AATAATCAAATTCCTTCCAGAAACGATTAAAATGAAAAAAAGTTTTTTAAGATAGAAAGT
TAAGAATCCATAAAATTTGAAGAGTAAGATATCACAAAATCATAAGCAATAAACAATCTA
AGAAAAGTTAAAAGATAAAAACTTTTAAGAAATCCTAAAATTGATGTTACACCATATACT
TCAATCATTCATACTAAGAATAGGATGATTATTCCTCATATGTATTAAAGACTATACATG
AATGATGATGGCTCTATAAGGTATGGAAAAATATTCAGAGAATGCGTTTCTATGGATATA
AAATATAAAATTGAAAATAAGCAGTATTCTGTAAAAGATGAAATTAAAGAATACAAAGAT
AGAGATAGTAGATTTTATATTTGCTTTAAAGCAATTGTATCCAGATATTTCCTTACTATA
GATGAAAAAACAAATGCAGCCTACCGATATATGAAAGACTATGCTATAGAAACATTTTCC
TATACAAAAAATGATTGGTATAAAGCATACGTTTAAGTTATTCATGAGAAGAGGTAAAAT
AAAAACATGCAGCTTCTTCCATTCCCAAAAGTAGTTTTGAAGGATGAGATGATAAAAGAG
GTGTTTTTTGATTTGGGCATTATAACAGATAAGGCTTAAAATCTAGGCTATGTTAGAAAT
TTTAGAATAAATATACATCTAATTAAAAATATGTTGATAGCTGATTGCTACGGATTAGTT
GATTATGATCCATTTTTCTTATATCCATGTGTTGGCGAGTCTATTCATCTTTAATTTCAT
GAAATCCACTCTGTAGAAGCCTTCTAACTTATTAAGGAATCTTATATCATGTGGATAAGA
AAATTGTTGGGAATTTAATATGTCAAGCTATGCCTGTAAAAAAATAAAAGTTTACCAAGC
TGGATGAATTTCGAAATGAGAAATGGAGTCATTATACTTGAAGGAATACCGGCCAATCAC
GATATTGATGACCTTTTAATACGTGTCTATAATGAAAATGAATATATTGTGCAACAATTT
TAGCTTAAAATAGCTGATGAAGTTGATCCAGAAGAAATCAAAGATTAATAAATAAATTAA
AAAGATCTTTATGAAATCAATTCTTTAGATGATTCTCTTTTTAAGTCAAAAGCAATCGAT
TAAACTGATTATAAGGAAGATAGAAAAGAAAATATGATTTATAGTTAATTTAAAATTACT
AACAAATAAACTTCTTAACGTTTTCTTGAAAACTAAAAGTAATAATCTAGCGAAATAATT
ACTAAATCTTAAAGAGAAAAATCAGAATAGGTAAGTATGACTAATATAGTTGACTTTAAC
TCTTACCGCCCTGATGACTAAGCATCTACTAGGCGTGATTAACTTATGCAGAATAAAAAC
GAAAATACAACAAATTTGGATGAGACTAATGTCTAAAAGCTCGCAGACGAAAGCATTTCA
AAGTATAAACCTGAGAAATTGGACCACGATATAACCTAAGATCAATTAAATATTAATGAT
TAATCAGCCTTAGAAATCAATAACAATATGAGCAACATACATTAAAAGAAGCATTCACAA
TATGAAGAATGA


>TTHERM_00266660(protein)
MNISFFSTLSSKLFLGIAILWINIKFLKAANYPQLVFSPSSLQQYDLRSQGGYSAKLAYA
QNASLVFAATGSLGVSVLDSKTYQIISQINLNNQTITGLDVTSDGEYVMMGYQNKFSVFK
YSNKNLTLLSQASFQSGVIMDVSLDQTETIAFGYGMPGQICAYNILNKNNIVFLTKFNTA
SNRVRQLYATLDNKYLLLADSTSGLNVIQVTNSQGNYQLKSIAVGTPAWDVMDVKFTNDY
QIAYVADFFYGLFYINLGFVFNSDPSAYPLQLGNQFISYWPFQVESVNSLAITSNNNYLL
VGQRGLGIKIIDISDKNNPAYYSDIPAVGHAFTILLVNNEQNIFFANSISIIVYGQSVLN
LNDQYPNLYNGFQSFMYSPSKTLYYWKCIIGKNDTYFYGVFDDGGVYIMTYGDDPYNMQI
LAYIMYNPTDQTDFMWINEDETLMILGISTNQYTLEVFDITDKTKPKLITQITKTESNDT
DGCVFTKDMTRFICANGGDGIFITDTTDIKNLKIIFTWPLESFMTGTVKDVVIKDNKYIL
GAIRNYGMCVLELTDPNTLVLRGYLQTNGGEGIALSNDLNYVYLKDGINGVTIVDIQNLP
NIHIVGQVQLEGWEEGIVRLQNDNYLVALTTDAGYAALIDSSNKSTPYVISKYNPNKEIA
YNGCTDSQENYIMILTNAGFRVLPIKTNLYIHTEIDLVTGQNSGQTVLTPLPKSQSLLIG
QTIQFTFLILYPEKNIKINQILYVDNYEIKQIPYWMTYSSSSQILTMSIVKEALGSGNIQ
KSLNTVIIQTLKQISSTDFIYNQTNATTTADQSMIIYKYLRQIQYIDNNGYITTLFDPES
DFQFIISGLTVTDKLQQQIKLTLARSFYQNPVVFYIESSLKINFQSSSDYITSQSSTITI
YFLIDSAQGKFVSLSYGGVITSTTEKLEQIKLEGSIENINRALQFGIFISRIDLNNDINV
QVTLQDGTNYDYQKTLNSKDISFIHTMETVQIGETLQSQINNWFPGSILDIATALNFQFS
SSSFQCASTVTLQYSAFLQKGGSYIPLPSDFWLQFDKNTIKFYGSATTSQYGQTFYLRVN
ATDGYTYTYQDFYIIMNGLPFVYVFNLLVQVFGPVIAILGVFQYKYQIFNVILKKQTTYS
PEIALVNKYFIKTFTVVGNDLLKARLIFQIFRENANRLSNNNQIPSRNDQNEKKFFKIES
QESIKFEEQDITKSQAINNLRKVKRQKLLRNPKIDVTPYTSIIHTKNRMIIPHMYQRLYM
NDDGSIRYGKIFRECVSMDIKYKIENKQYSVKDEIKEYKDRDSRFYICFKAIVSRYFLTI
DEKTNAAYRYMKDYAIETFSYTKNDWYKAYVQVIHEKRQNKNMQLLPFPKVVLKDEMIKE
VFFDLGIITDKAQNLGYVRNFRINIHLIKNMLIADCYGLVDYDPFFLYPCVGESIHLQFH
EIHSVEAFQLIKESYIMWIRKLLGIQYVKLCLQKNKSLPSWMNFEMRNGVIILEGIPANH
DIDDLLIRVYNENEYIVQQFQLKIADEVDPEEIKDQQINQKDLYEINSLDDSLFKSKAID
QTDYKEDRKENMIYSQFKITNKQTSQRFLENQKQQSSEIITKSQREKSEQVSMTNIVDFN
SYRPDDQASTRRDQLMQNKNENTTNLDETNVQKLADESISKYKPEKLDHDITQDQLNIND
QSALEINNNMSNIHQKKHSQYEE


>TTHERM_00266660(gene)
ATGAATATTTCTTTTTTTAGTACACTCTCTTCAAAATTATTTTTAGGAATCGCTATTTTA
TGGATAAATATTAAGTTTCTTAAAGCTGCAAACTATCCTCAATTAGTCTTTTCTCCTTCT
TCCTTGTAGCAGTATGACCTTCGTAGCTAAGGTGGTTATTCAGCTAAGCTTGCCTATGCT
TAAAATGCTAGTCTAGTTTTTGCAGCAACAGGATCATTGGGAGTATCAGTTTTAGATTCA
AAAACATATCAGATAAGTAAATATAATTTTAGCATTAAATTTATGTTTTAAAATAGTTTT
ATTAATTTTATATCTCTATTTTAATGTAGTTAGCTAAATTAACTTGAATAATCAAACCAT
AACTGGTTTAGATGTTACTTCAGATGGTGAATATGTAATGATGGGATATTAAAATAAATT
TTCAGTCTTCAAGTATTCAAATAAAAATCTTACTCTTTTATCATAAGCCTCATTCTAATC
AGGAGTAATCATGGATGTAAGTTTAGACCAAACTGAAACTATAGCTTTTGGATATGGTAT
GCCAGGTTAAATCTGTGCTTACAATATTTTGAATAAAAATAATATTGTCTTTTTAACTAA
ATTTAACACTGCTTCTAATAGAGTAAGATAACTTTACGCGACTTTAGATAACAAATATCT
CCTTCTTGCAGATAGCACAAGCGGTAATTTTTAGTCAATAATTTAGTTAATTTCTTTGTC
ATTAATAATTTTTCAAATAAAAAAAACACTTATAAAAATTAAATAGGGTTAAATGTTATT
CAAGTTACGAATTCATAAGGAAATTACTAATTAAAAAGCATTGCAGTTGGCACACCTGCG
TGGGATGTGATGGATGTTAAATTTACTAATGATTATCAGTAAGAAATATATTTTAATTTA
TTTTTTTAATTTGGAATTTAGATTATTTATTTTCATTATTGAAGCCACTTTATTATTTAA
CTTATAAAGAATTAATTAATTAAAAATAAATAAATAAATAAATAATTTAAAAAATTTAAT
TATTCAATAATTTATCTTATTAAGGTTCTTCTATTTTAATTACTTTTTTGGCTTTAATTT
ATATAGGATTGCTTATGTAGCAGATTTCTTTTATGGCCTGTTTTATATTAATCTTGGTTT
CGTTTTCAATTCAGATCCCAGTGCCTATCCTTTATGTAAGATTCTCAAAGCTTATAATTA
TCAAAATTCTCATTTTAATTTAATAAGAGCTAGGCAATTAGTTTATATCTTATTGGCCTT
TTTAGGTAGAGTCTGTAAACTCATTGGCTATTACTTCAAATAATAATTATCTACTTGTTG
GTTAAAGAGGTCTTGGCATTAAAATAATTGATATCTCTGACAAGAATAATCCAGCTTACT
ATTCTGATATACCTGCTGTGGGTCATGCATTTACCATTTTGCTAGTCAACAATGAACAAA
ATATTTTTTTTGCAAACTCAATTAGCATTATAGTTTATGGCTAGTCAGTCCTAAACTTAA
ATGATTAATATCCTAACCTTTATAATGGATTTCAATCATTTATGTATTCACCATCGTAAT
TTTAGAAAAACAATTTCTTTAATTTTAGTTTGAATAAAATGATTATAATTTTTCTAAAAC
ATCCAACAAGCAAATTAATTTACAAAAATGAAACTATCTTTTATTAATTTATTTTACCTA
TTTTATAAATATATTTATAATTTGAACAGTAAAACACTTTACTACTGGAAGTGCATAATT
GGTAAAAATGATACATATTTTTATGGAGTTTTTGATGACGGAGGAGTTTATATTATGACT
TATGGCGATGACCCTTACAATATGTAAATTTTAGCATACATAATGTATAATCCAACAGAC
CAGACTGATTTTATGTGGATCAATGAAGATGAAACCTTGATGATATTGGGAATATCAACA
AATTAATATACATTAGAAGGTAAATGAGTTATTTATTTATTTATGAATTAATTAATTAAT
TAATTTATTATAAATGTTTATCTCTAAATTTTCAAAAAAATAAGTTTTTGATATCACTGA
TAAGACAAAACCAAAACTAATTACTTAAATAACTAAAACGGAATCTAATGACACAGATGG
TTGTGTATTTACTAAAGATATGACACGTTTTATTTGTGCTAATGGTGGAGATGGTATCTT
TATAACAGATACAACAGATATAAAAAACTTAAAAATAATATTCACATGGCCTCTTGAAAG
TTTTATGACAGGAACCGTGAAAGATGTAGTTATAAAAGGTATTTTTGAATTTAAAAATAG
AAAAATAGGCTATATACTTATTTTAAAATTTTAAAGATAATAAATACATATTAGGAGCTA
TAAGAAATTATGGAATGTGTGTCCTAGAATTAACAGATCCAAATACACTTGTTCTTAGAG
GTTATTTACAAACAAATGGTGGTGAAGGAATTGCTTTATCAAACGATTTAAACTACGTCT
ATCTCAAAGATGGTATTAATGGAGTAACAATAGTTGACATTTAGAATCTACCAAATATTC
ATATTGTAGGCTAGGTTCAATTAGAAGGCTGGGAGGAAGGTATTGTTAGATTACAAAACG
ATAATTATTTAGTTGCATTAACTACAGATGCAGGCTATGCGGCTTTAATAGATTCTTCAA
ATAAAAGCACACCTTATGTTATAAGTAAATATAATCCAAATAAAGAGATTGCATACAATG
GATGCACAGACAGCTAGGAAAACTATATAATGATTCTTACAAATGCTGGATTTAGAGTGT
TGCCAATTAAAACAAATTTGTATATACACACAGAAATAGACTTAGTTACAGGACAAAATT
CTGGCTAGACAGTTTTAACTCCTCTCCCAAAATCTCAAAGTCTTTTAGTAAGTGCTTAAT
TTAAAACTTTATGAGAATTAAATTTCATTTAAAAATAAAGATAGGATAAACTATTCAGTT
TACGTTCTTGATTCTTTATCCAGAAAAGAATATCAAAATAAATTAGATTCTTTACGTGGA
TAATTACGAGATAAAACAAATTCCCTACTGGATGACATATTCAAGCAGTTCATAAATTCT
AACAATGTCTATAGTAAAAGAGGCTCTAGGCTCTGGTAACATTTAGAAAAGCTTAAATAC
TGTAATAATACAAACACTCAAGTAAATTTCATCAACTGATTTCATCTACAACCAAACTAA
TGCTACTACAACAGCAGATCAGAGTATGATAATATATAAATATCTTAGATAAATTTAATA
TATTGATAATAATGGATATATAACAACTTTATTTGATCCTGAAAGTGATTTTTAATTCAT
TATTAGTGGATTGACTGTAACAGATAAATTGTAATAGCAAATCAAATTAACACTCGCCCG
TAGCTTTTATCAGAATCCTGTAGTATTTTACATAGAGTCTTCTCTTAAAATAAATTTTTA
AAGCTCATCTGATTACATCACCTCTCAATCAAGTACCATAACTATTTACTTTTTAATTGA
CTCTGCTTAAGGAAAATTTGTTTCCTTATCATATGGTGGTGTCATTACTTCAACAACAGA
GAAACTTGAATAAATTAAGCTAGAAGGTTCTATTGAGAATATTAATAGAGCTCTTTAATT
TGGAATATTTATATCAAGAATAGATTTAAATAATGATATAAATGTTTAGGTCACTCTTTA
AGATGGAACCAATTATGATTATTAGAAAACATTAAATTCAAAGGATATATCTTTTATCCA
TACGATGGAGACCGTATAGATAGGTAAAATAATTAATAATTACTTCACAACCTCAATATA
ACCATAAAAATAATTAAAAAATACCTTACTTTAAACACTAAAAAATAATTAATAAACTTT
AAACAGTTTGTTAGACTTATTATAATTAATAACCAAAATTTTTTTCAAAAGATCCTTCCT
CTTTGTAGGCCTGTTTTTGCAAAAAAAAAATGAGGACCAAGGATTCAAGGATTTCTATAA
AAAATTTATTGGCAAATTTATTTTTCATAAAAAAAAATATCTATTTTATCACTGATTACC
AGTTATTTATTAGCAGATAAACTGATATATATTCACACCTTTTCAAATTTAAATTGAAAA
TTGAAAACCAAAATTTTATTCAGAAAATATAATTATCCAAAATATTTTGCAAAAATTTGA
TTAAGAATTAGTTAAAATTAATCTTATATAATTAGATTCCAAAAGCTCAAAAATAAAAGA
TTTTATAGATTAAATATTTAACATCTTTTTTTGATAATTTTACAAAACTTTTGAAAAAAA
ATTAAATTCTTATATTTTATAAAACTCATCGTTTTTATCATAAAATTTTCCCCTCTAATT
CCACCATTGATATGAATTATGTATAAAACACATTAATATGATAGCTGAGATAGTAAATAG
TGAGCTAATTAGATATGAACTTATTTATTTATCAATAAAAATTAAATAAATGTTTTTTAA
TTTTTAAGATTTATATATTTATAAATAATTTTATTTATTATTTGATAGGTGAAACTTTAT
AATCCTAAATTAATAATTGGTTTCCCGGAAGTATATTAGACATAGCTACTGCATTGAATT
TTTAGTTTTCATCATCTAGCTTTTAGTGTGCATCCACAGTTACATTGTAATATTCTGCTT
TCTTATAGAAAGGAGGTTCTTATATTCCACTACCTAGTGATTTTTGGTTGTAGTTTGATA
AAAATACAATCAAATTTTATGGTTCCGCAACTACTTCACAATATGGATAGACATTTTACT
TAAGAGTGAATGCTACTGATGGATATACCTATACATACTAAGATTTTTATATAATCATGA
ATGGTCTTCCTTTCGTATACGTTTTTAATCTTTTGGTTTAAGTTTTCGGTCCAGTAATAG
CTATTCTTGGAGTTTTTTAATATAAATATCAAATCTTTAATGTGATTTTAAAAAAGTAAA
CAACTTACTCCCCAGAAATAGCTTTAGTTAATAAATATTTTATAAAAACGTTTACTGTTG
TTGGAAACGATCTTCTAAAGGCTAGATTAATATTTTAGATATTCAGAGAAAACGCAAATA
GATTATCAAATAATAATCAAATTCCTTCCAGAAACGATTAAAATGAAAAAAAGTTTTTTA
AGATAGAAAGTTAAGAATCCATAAAATTTGAAGAGTAAGATATCACAAAATCATAAGCAA
TAAACAATCTAAGAAAAGTTAAAAGATAAAAACTTTTAAGAAATCCTAAAATTGATGTTA
CACCATATACTTCAATCATTCATACTAAGAATAGGATGATTATTCCTCATATGGTAAAAT
AAAAACATTTATTTTATATGTTTAATTTAATAAATTCAACTAATTTTATTATTTACTTTA
ATTGATTTTTTTCAAAGTATTAAAGACTATACATGAATGATGATGGCTCTATAAGGTATG
GAAAAATATTCAGAGAATGCGTTTCTATGGATATAAAATATAAAATTGAAAATAAGCAGT
ATTCTGTAAAAGATGAAATTAAAGAATACAAAGATAGAGATAGTAGATTTTATATTTGCT
TTAAAGCAATTGTATCCAGATATTTCCTTACTATAGATGAAAAAACAAATGCAGCCTACC
GATATATGAAAGACTATGCTATAGAAACATTTTCCTATACAAAAAATGATTGGTATAAAG
CATACGTTTAAGTTATTCATGAGAAGAGGTAAAATAAAAACATGCAGCTTCTTCCATTCC
CAAAAGTAGTTTTGAAGGATGAGATGATAAAAGAGGTATTAAAAATGTATGGATTATAAC
ATTTTAATTATTCATTTTATAAATAAATAAATAGGTGTTTTTTGATTTGGGCATTATAAC
AGATAAGGCTTAAAATCTAGGCTATGTTAGAAATTTTAGAATAAATATACATCTAATTAA
AAATATGTTGATAGCTGATTGCTACGGATTAGTTGATTATGATCCATTTTTCTTATATCC
ATGTGTTGGCGAGTCTATTCATCTTTAATTTCATGAAATCCACTCTGTAGAAGCCTTCTA
GTAAGATTTTATAAAATTTTAATTACACTCTTCAAATATATAATTAAAAATATGTTTTCA
CTATAAAATTAATTTAATTTCATGAAGTAATTTAAAATTTTATACAAAAGACTTATTAAG
GAATCTTATATCATGTGGATAAGAAAATTGTTGGGAATTTAATATGTCAAGCTATGCCTG
TAAAAAAATAAAAGTTTACCAAGCTGGATGAATTTCGAAATGAGAAATGGAGTCATTATA
CTTGAAGGAATACCGGCCAATCACGATATTGATGACCTTTTAATACGTGTCTATAATGAA
AATGAATATATTGTGCAACAATTTTAGCTTAAAATAGCTGATGAAGTTGATCCAGAAGAA
ATCAAAGATTAATAAATAAATTAAAAAGATCTTTATGAAATCAATTCTTTAGATGATTCT
CTTTTTAAGTCAAAAGCAATCGATTAAACTGATTATAAGGAAGATAGAAAAGAAAATATG
ATTTATAGTTAATTTAAAATTACTAACAAATAAACTTCTTAACGTTTTCTTGAAAACTAA
AAGTAATAATCTAGCGAAATAATTGTAAATTAAATAATGATTTATATAATTAATTAATTT
TTTCAATAATCTTTTTTAATAATTAGACTAAATCTTAAAGAGAAAAATCAGAATAGGTAA
GTATGACTAATATAGTTGACTTTAACTCTTACCGCCCTGATGACTAAGCATCTACTAGGC
GTGATTAACTTATGCAGAATAAAAACGAAAATACAACAAATTTGGATGAGACTAATGTCT
AAAAGCTCGCAGACGAAAGCATTTCAAAGTATAAACCTGAGAAATTGGACCACGATATAA
CCTAAGATCAATTAAATATTAATGATTAATCAGCCTTAGAAATCAATAACAATATGAGCA
ACATACATTAAAAGAAGCATTCACAATATGAAGAATGA