Identifiers and Description

Gene Model Identifier

TTHERM_00297160

Standard Name

ESP1 (Extra Spindle Pole bodies)

Aliases

PreTt15727 | 27.m00387 | 3692.m00189

Description

Separase protein, required for mitotic and meiotic chromosome segregation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR01612 ) rhoptry protein
  • ( PF03568 ) Peptidase family C50
  • ( PF01473 ) Putative cell wall binding repeat
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( TIGR01590 ) yir/bir/cir-family of variant antigens

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00297160

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08868.19.997093137033517e-262hypothetical protein (2039 aa)
DictyBaseDDB_G02903251.0002124404074584e-26espl1 on chromosome: 5 positio
n 3958340 to 3965920
SGDYGR098C2.0009605191578312e-25ESP1 Separase, a caspase-like
cysteine protease that promote
s sister chromatid separation
by mediating dissociation of t
he cohesin Scc1p from chromati
n; inhibits protein phosphatas
e 2A-Cdc55p to promote mitotic
exit; inhibited by Pds1p
WormBaseWBGene000047752.999758165421992e-18locus:sep-1 status:Confirmed
UniProt:G5ED39 protein_id
:CCD72557.1
Stentor CoeruleusSteCoe_329660.000000000000004658886145103398

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23555314: Howard-Till RA, Lukaszewicz A, Novatchkova M, Loidl J (2013) A single cohesin complex performs mitotic and meiotic functions in the protist tetrahymena. PLoS genetics 9(3):e1003418

Sequences

>TTHERM_00297160(coding)
ATGAACTATGAGAATGCTATCTAGTTGATAAATGACCCTACTTTTTTGAGGTAGGAAAAT
AATATCCATTAAATTATTTAGCTTATTTAGCAAGCAGGGCTTTAGTAAAATTTAAAGAAA
AATTCAGTTAGCCTTGTTACTAAATTTCTTTAAGTTATGTGTGCATAGAAGGATATGAAA
AAGAAAATATTTTTAGATAGCTTATTAGAAAGTCTCAAAGCAATATAATTAGCTACAAAA
AAAGGGCTTAAAATAGATATGAAAATAATAATTATGAAAATTATATCTTTTGCAGGTGAT
AATTCTTTTATTGATGAAGGTTTACTTTTAAGTAAATATTATTACTACCAATAAAAAAAT
CCTTCATGCTTTTACTACGAGTTTTCAAAAACAAATCCAAGATGGAACTTAACTGATTTA
GAAGCTGACATAATTAAGAGTACTGATGATCCAAAGGATAAAGAAAAGAATACATATGTA
TTGATTTCAAGAATTAAATTATTGTAGAGAACTGTTGGAGGATTTAGCAGTTACTATGAA
GAAACAAAATCTAATTTGTAACTCGCCTCTATTGTCATCAGTGAAAAAGACTCTTACTTT
AAAGATTATATATTCCTAACACATAAAATGATAATTAATGCACTCAAAGGAAATGAAAAA
ATCGATTAAGGTACTATATGTTCATTTTACTTTTATCACCTAACTTAAGAGAATATTACA
ATAGATTAGTTTGGTGCTATGCTAGTAGATATACTCAATCTAAATAAATAAAATAGTTTT
TAAAAAAATATGATTCATTCTATAATAGTGGATTGTATATAACTCATATCCAACAAGAGC
TCAAAAAAAATATACACTTAGATTTTTGAAAATAAAATTGTTATAAATATGATAGAAGTA
CTGTGCTTTTAACTAGAAGACTTGTAATTAATTGAAAAAATTGCACTTTATTTGAGTGAA
ATACCTTATAACTAAAAGATATAACATATAAGTATATTGTTAAAGATTTCTTCAGCATTA
AAAGAAGAAAAATAAGCAATTGAAGAAAATAATTTCTAAAAAAGCTAACTTTAATAAAAA
TAATAGTAGAAATAGTTATTCAAATATGAGTAATAGTAAAATTTAAATAATTTTTCATTT
AATAGTGACCAAGAAAGTATGACTATTGTTTAAGAGTAGCTATCACATAAGAATCAAAAT
ACTAATGCAAGTTCATTATTTACTGTTACTTAACCACACATGAATAAAAATTAGAAAAGT
AATAATAATGGTAAGAGCAAATCAAGAAGAAGCAAGAGTAAATAGCGAATATCTAATACT
TAATTAGAAAAAAATGAATAAATAAAATAAAATGACTAATTTGAAGATACGACTAATAAC
AATTATAATCAAAATGCTAATGCTAATATTGAAAATTAATACTTTGATAATAAGGAGAAT
ATTTTTTAGGAGAATTTCATTTAAATCGCTGCACCTGCAAATGCCCTTCAATAGCAAGTG
GTTTTAAAAAAAATAAAAGAAGAAGATTAATTTTATAGATTGTGTGAAGACTACTAAGAA
CTCGATATAAAGGAAGTTGGAGGTATACAAGTAATGATGGCTTATAAGATTTTTAATTAA
ATTTAAGACCTGAAAAATATTTATTTTAATAGCAAACTAAATAATCGAGAAATATTAAAA
GAATTAGAAAAACCCAAGTCAAATAGTATGATGTCTGACAGCACTGGTGCATAAAGAAAA
AATATTTAAAATGACATTATTGATTAAGATTTGTTAAATATATTGATTATTTAAAATGAA
ATTTGTGAGCTGATTAATGAGTAAGAAATAAATCGCTAAGAGATTAGGTGCTAAAATTTA
TTCTATATATTCACTTTTTTTTTAAGTATGATAGAAGATTAAGATAATATTTATTTCAAC
TACAAAAGAAATAGAAGGAAAGGGGGAAATAGTGGTTACTAAGTTATTTCTGTTTAAATA
AAGTTATTAGTTGAGGATATGTTTAAGTATCACAGATATTAGAATATTGATAAAATAGAT
TCTAAATCATCTAAAGGCAGATCTTTTAGAACTCTACCTGAATATAAACAAAAGATGGAG
GAGATTAGAAATTTTTAGATGAGCTATACAATTAAATGTTCTATAGCATTATTTAAGAAT
AACTTGGATATTCATGTATCATAAGATCTAGTTGATACTATAGTAGAAAATTTAGATTTT
GAGGATTTAGATTTAATTCATACACTAATTTTAGCATTCGCTTAGTAAGAAAATATAGAT
TTGAATAAAAAGCTTAGTATAGTTGCAGATAGGTCTATTGAGCTATTTATTTCAATGCAT
AACTTTTAAAATGATTGCTAAAACATCAAAGAAAGCTAACGATTAGTATCTAGCGTTTAG
AAAGAATAAAAAGCCATTTCAGATTTACAGAAACTTATGAAAAAGTTAGAATGTACCTGT
GTAATAAATTTAGTTTATTTACACCATGCATCTATAGATTAAAAAATAAGAAACTCTCAT
ATAGTTTAATGCTTAAATAAAAAGCTCAATGAATTCAAAGAATGTGTTTTAAAAAATCAA
ATCGATTCCTAGCAGTTGTATGTCTAAATAATGATGGAAACAGTCTGCAAATATATGTTT
AGTAAGAAAAAGAAAAGCTAATAACTGAAAAAGCTTAATTTATAAGGAGTTTTTGAAGAA
ATAGGAAACAATTTTTCATAGATACTTTCTTGGAACGAAAAAAATCTTTTGGAACAATTA
GGTTTTTTTATTTAATACATGGAATTTAGTGATTTTTGCATTACATAAATGTAAAGAGAT
AAAAATGAATTTGGAACAGAAGAATCTATTGAAATGCAAAAAAATTTAAATATAATTAGA
AGAATGACAGTTAAAAATCTAGAGTCTTTTCATAATGTAGACAGTTTAGATGTCAGCAAT
GAAAAATGTTTTAATAAAGTGTTAATTCAAGTTTTGACAAAGATCGTTTAAATAATTAAC
ACTAAATTTAACATTTAAAAGTCTGCACTGTAGATTAGCTTTAAAACTATTAACTTGAAG
CTTACTCTTATCAACAAAATTATTTGTTTAATATTAGAAAATAAACTAAAAGACACAGCT
TCAATATAAAATTTAACTGCAATATAAGTTCTCTATGAATCAAGCACATACTACAATTAA
ATACTTTTAATGCTTTTAGAAATAAATGAAGACATATACTATATTTTGTAGCATAATACA
GGCTCAAATTAATAGAATTGGGATTTATAACACACTCATTCATTTATAGTTAATTTTTTA
CTAGCTTCTGAAAACATCCAAGGGTCTCCCTTAATACCAAAATTCAATTTTTTAAGATAA
AATTTATCATGGAGAGAAGTTAAGCAGTTTTTACACACACTTAAGTATATAAGAGAATTA
GCTAGTTACTTTTAAGTTGGAATTTTGTAAGCAAATATTATTGTATTTGAATTACTATTA
TTGAGGTTTTTAAATTATGAAGGCTAGTTTTTGAAAAATACAACACTAGATTTTCATGAA
AAAGATTTCTCTGAACTATCTAGTGTATCTTAAGAGTATAGCATTGGTTTTTAAAGTGAT
AAGGATATAAAAGAAGATTCTTTTTTTAAGTTTATTGAATTGAGAATAGAAGAAAAGTTG
GAAGAATATATTTAGGTCCTCCATTAAAATTAGAAATCCGATGAAGCTAAAAAATTATTA
ATCTACTCTAAAGCCAATTCAAAGATTGAAGATATTTAATCTTGGTTATAAGAAATATAA
CAATGCTTAAAACGCAAAAGAGTGAGCTGTGGAAAGCTTATAGAAAAAAATACTAATTAA
ATAAAGTATATAATCCATGAAATTAACGTTCTTAGGATAGAAAACAACAAGATCGCTTCA
TTTTAACCAGACAATCTAAATGAATAAACAACTAAAATTCATTATAGAGATATCATGAAG
GAGGCAGATGAGATTGAAAATGAAATAGAGAGTTATGATAGAAATTCTATTTCTTCATAA
AATAAACAAATTCTAAAACTAGATTATATAGTATTAAGCCTAAGAATGCATATATATTGC
GCCTAGTATATCAGAAATAGCAATCAATCATATTTTTCTACTTAACTCATGGAGAAGGCT
TTTAAAAAGCTAACTTCGATTTGCTTTGAAAAGGCTGTAGGTAACTTAAGTGACATTTAT
GAAAACTATTCTCTTTAATAAGGCGCATGCTAAATGTACCATGCTGCAGCGAAGACTTAA
TAGGAGATAAGTGCTTAACAGTCACAAATAGGATTTATCATCAATCCCTTTACTAAAATT
TAGACTTTAGTCAATAACAGGAAATACTCCTCAAGCAATAAAATATTAGGAGATTTAGTA
GAGTATCTGAACATAGGGAATGGCTTTTCTTACTTTAAAAATACAGGAAGCAAAAGAATA
TAATAGCTGCTAATTCAATGCTTAAAATTATATTGCAAGAATTAAAATTCTTTAAATTGC
TTTAATAATCTTAAATATTATGGAAAGCTTTTACAAATAACTAGTATTAGATTCCTTGTT
TTGCATGAATTTTTAAGGATTTAGACTATTCTAAAGGACTACTCTGATTTCTTAAGAAAC
GGCGTTTTAATTGATATAATAGGTAATCTATTGTTATAAAAATAGTTTAATCTACAAACT
CTTCATAATTTATTTAGCAAGCGTAAATCCAGTGTTATAAATATGTAACTCAGTAATTTC
ATCTAGTCTCTAAATGATAAACTTTTAACATAAGATTTAGATTTAAGATCCACAAAAATG
TATAAAATATCTATGCAATACATGATTTCCTTGTTTACCTCTTCAGTACGTATAAATCAT
AAAAACTTAGAGAGTGAAATTTGTGAAATGATATTTTTTTCAAAAAAGAAATTCTATTTT
CTCAATCCATAACTCCATCAAAATTTGTAAGAGAATTCTGAAATGTCAAGAAATGGAAGT
GTCGAAATAAATAAAAATAAGAAAATGATTTCGAGAAATCAGAATTAAATAAATGATTCA
AAACTAAATAAATTTCCTTCAGGAGTATGCTAATTATTTTATAATATTCTCTCTATCGAT
AAGAATAACTCAAAGTAATAAACTTATTTCATAGTAAATGAAGATTTTTGCTCCCATATT
ATATCTCATAAAAACTATTATTCATTTACATTGAGATACCTTACTTTAATGCAATCATTA
AACTTACTGAGTAAAATAACAGACTGCAGATTGAGCATGAGCGAAAACTCTAATTAAAGT
AAAAATCCAACAGTTTTATGTGACGAAATACATGGAAATTTTATAGCTTTAATTAATTTT
AGGTAGTTATGCCAGCTGATGCATAATTCTTATCTATAATATAATTTGACATATGCAAAG
CAATTCTTTTATCTTTATCATAAATTTGATGAAACTATAAAAGAGCTATTAAGAGAAATT
CCATATCTAATATAAGTTTATTAAAATAATACAGTTGTAAAAAATTGTTCATGTTTGCCT
TCTTCCTAAGTTAAAGCTCCTTTGTTTTTGGATGGAAGCAGATAACTCATTACTGAATCG
TTTGCTCTTGATGCTTCGTACATGTATAAAAAAATGCTTGTTAATTCATAAGATTTATCA
GAGTAGTAAGATGCTATTTTGCTAGAATAAGAAAATTTTGAAGAACCAGATTCGAGCATG
AAGCAGTCATCATCCATGTCAAGTGATTAAAGTGAATAAAAATTACAAAATTAGCAAAAT
AAAGTAAAATAAAAAAATAATCTAATGATGGATGAAACAGAAACAGCTATTAATTCTAAA
TAATTAGGGCAGTTTGAAAAGTTAAGCTCAGTAAATAGTATTTAGCAAGCTTAAATAAAT
TTTGAGTTCAAAAGATTGAGAACAAGTATGAGAGATTTTAGCATTAGCAAATATGCTAAA
AGTGACCTAACTTAAGTTTTATAAAAGTCTTTCAAATACAGCAGGATTGATAACTTTAGC
TAGAGGCATTATTAATTTTAACAAATAAAGTTAGAACATGATTTGATAATATTAAACTTT
ATTGATTATAATAACGAAAGGGCAATTCAAATATCAAAGTTTAATCATCTTAACTAAAAT
TATTCTAATTTTAGAATTAATAGTCAATCTCAAACTAATTTATTTTCAGACTACATAAAT
GACATAAAAAGAATACTTCAAAATAATGAATCTGATATGAGAAACGATGAAAAAAAGCGA
AAGTCTTAAGTTGATCCAAATAACTGGTGGAAAAGTAGATATAGCAATGACAAATAACTT
GAGAAAATCCTTAGCCAAACTCAAACCATTCTTGACTATCACATATTTTTGTTCTTTGGA
AGTGAATAAACAGAAAGAGAAAAAAAAATAATGTAAGATATTTTAGTAAGGATAAACTAA
TGTGAATAAATATGCATAGCTAATTAACCAAATGATCAATGTTCTTTATTTGAAAAGCAT
ATTTTAATTCAAGAAAAAAATAATTTAATAGAGCTGTTATTCTCTTTGATTAAATGTTCT
TTGTTTATAACTTTGAACTAAACAAAATTAAAGCTCATTTTTGAGTTGATGTGCATTCAA
AATATATATTTGTAATACTTAGGTTTTCAATCTTAGCAATAACTTTTTTCAGAGATTTGC
AAACTATAAAATGAGTACTAAAAAAGCTATAATCCTTCATAAAGAAAACCAATGATGTGG
ATTCTAAGTGAAAATCTTTTACAGGCACCTTTAGAATTTATGAACTGCTTTTCTGAAAAT
AATTAAACTTTCTATAGAATACCCTCTTTATAATACCTTTATGAGAATTACACCCCTAAT
AACAGTGTAAATTTCTCTAATAATTATTATTTACTAAACCCTTCTGGAGATCTGGTTCAT
ACTTAATCTAAATTCTAACATAAATTTGAGTCGATAAGGTCATGGGAAGGTGCTAGTGGA
TTTAGTGTAAGTACTAAAGAACTCTAAAAAGTACTTAAAAATTATCAATCGTATACATAC
ATCGGACATGGGGCAGGAGAGCTCTATATAAATCAAAAGCAAATTTAAGAAATAAAAAAC
ATAAAATCTGCTATTTTGCTATTTGGTTGTCAATCAGCTAGATAAGCTGTGTAGTTAGAA
TTTAACTCTCATTAATACGAAGTTACAGGAAATAGCTTATACTTTTTAATGAATAATTGT
AAAGTCCTTATTGGGAGTCTTTGGGATATAACAGATAGAGATACTGATAGGATGGTTTTA
AAATTAATTTAAATTATTGAAAAAGCTAGTTTGAAGAAACCTATTGATTTTAGCTAAGCA
TTTTTACAGTCGAGAGAGGAATGTAAACTAAAATGGCTTAATGGATCATCATTTGTTTGT
TTTGGAATCCCAACTTAATTCCACATGAAATGA


>TTHERM_00297160(protein)
MNYENAIQLINDPTFLRQENNIHQIIQLIQQAGLQQNLKKNSVSLVTKFLQVMCAQKDMK
KKIFLDSLLESLKAIQLATKKGLKIDMKIIIMKIISFAGDNSFIDEGLLLSKYYYYQQKN
PSCFYYEFSKTNPRWNLTDLEADIIKSTDDPKDKEKNTYVLISRIKLLQRTVGGFSSYYE
ETKSNLQLASIVISEKDSYFKDYIFLTHKMIINALKGNEKIDQGTICSFYFYHLTQENIT
IDQFGAMLVDILNLNKQNSFQKNMIHSIIVDCIQLISNKSSKKIYTQIFENKIVINMIEV
LCFQLEDLQLIEKIALYLSEIPYNQKIQHISILLKISSALKEEKQAIEENNFQKSQLQQK
QQQKQLFKYEQQQNLNNFSFNSDQESMTIVQEQLSHKNQNTNASSLFTVTQPHMNKNQKS
NNNGKSKSRRSKSKQRISNTQLEKNEQIKQNDQFEDTTNNNYNQNANANIENQYFDNKEN
IFQENFIQIAAPANALQQQVVLKKIKEEDQFYRLCEDYQELDIKEVGGIQVMMAYKIFNQ
IQDLKNIYFNSKLNNREILKELEKPKSNSMMSDSTGAQRKNIQNDIIDQDLLNILIIQNE
ICELINEQEINRQEIRCQNLFYIFTFFLSMIEDQDNIYFNYKRNRRKGGNSGYQVISVQI
KLLVEDMFKYHRYQNIDKIDSKSSKGRSFRTLPEYKQKMEEIRNFQMSYTIKCSIALFKN
NLDIHVSQDLVDTIVENLDFEDLDLIHTLILAFAQQENIDLNKKLSIVADRSIELFISMH
NFQNDCQNIKESQRLVSSVQKEQKAISDLQKLMKKLECTCVINLVYLHHASIDQKIRNSH
IVQCLNKKLNEFKECVLKNQIDSQQLYVQIMMETVCKYMFSKKKKSQQLKKLNLQGVFEE
IGNNFSQILSWNEKNLLEQLGFFIQYMEFSDFCITQMQRDKNEFGTEESIEMQKNLNIIR
RMTVKNLESFHNVDSLDVSNEKCFNKVLIQVLTKIVQIINTKFNIQKSALQISFKTINLK
LTLINKIICLILENKLKDTASIQNLTAIQVLYESSTYYNQILLMLLEINEDIYYILQHNT
GSNQQNWDLQHTHSFIVNFLLASENIQGSPLIPKFNFLRQNLSWREVKQFLHTLKYIREL
ASYFQVGILQANIIVFELLLLRFLNYEGQFLKNTTLDFHEKDFSELSSVSQEYSIGFQSD
KDIKEDSFFKFIELRIEEKLEEYIQVLHQNQKSDEAKKLLIYSKANSKIEDIQSWLQEIQ
QCLKRKRVSCGKLIEKNTNQIKYIIHEINVLRIENNKIASFQPDNLNEQTTKIHYRDIMK
EADEIENEIESYDRNSISSQNKQILKLDYIVLSLRMHIYCAQYIRNSNQSYFSTQLMEKA
FKKLTSICFEKAVGNLSDIYENYSLQQGACQMYHAAAKTQQEISAQQSQIGFIINPFTKI
QTLVNNRKYSSSNKILGDLVEYLNIGNGFSYFKNTGSKRIQQLLIQCLKLYCKNQNSLNC
FNNLKYYGKLLQITSIRFLVLHEFLRIQTILKDYSDFLRNGVLIDIIGNLLLQKQFNLQT
LHNLFSKRKSSVINMQLSNFIQSLNDKLLTQDLDLRSTKMYKISMQYMISLFTSSVRINH
KNLESEICEMIFFSKKKFYFLNPQLHQNLQENSEMSRNGSVEINKNKKMISRNQNQINDS
KLNKFPSGVCQLFYNILSIDKNNSKQQTYFIVNEDFCSHIISHKNYYSFTLRYLTLMQSL
NLLSKITDCRLSMSENSNQSKNPTVLCDEIHGNFIALINFRQLCQLMHNSYLQYNLTYAK
QFFYLYHKFDETIKELLREIPYLIQVYQNNTVVKNCSCLPSSQVKAPLFLDGSRQLITES
FALDASYMYKKMLVNSQDLSEQQDAILLEQENFEEPDSSMKQSSSMSSDQSEQKLQNQQN
KVKQKNNLMMDETETAINSKQLGQFEKLSSVNSIQQAQINFEFKRLRTSMRDFSISKYAK
SDLTQVLQKSFKYSRIDNFSQRHYQFQQIKLEHDLIILNFIDYNNERAIQISKFNHLNQN
YSNFRINSQSQTNLFSDYINDIKRILQNNESDMRNDEKKRKSQVDPNNWWKSRYSNDKQL
EKILSQTQTILDYHIFLFFGSEQTEREKKIMQDILVRINQCEQICIANQPNDQCSLFEKH
ILIQEKNNLIELLFSLIKCSLFITLNQTKLKLIFELMCIQNIYLQYLGFQSQQQLFSEIC
KLQNEYQKSYNPSQRKPMMWILSENLLQAPLEFMNCFSENNQTFYRIPSLQYLYENYTPN
NSVNFSNNYYLLNPSGDLVHTQSKFQHKFESIRSWEGASGFSVSTKELQKVLKNYQSYTY
IGHGAGELYINQKQIQEIKNIKSAILLFGCQSARQAVQLEFNSHQYEVTGNSLYFLMNNC
KVLIGSLWDITDRDTDRMVLKLIQIIEKASLKKPIDFSQAFLQSREECKLKWLNGSSFVC
FGIPTQFHMK


>TTHERM_00297160(gene)
ATGAACTATGAGAATGCTATCTAGTTGATAAATGACCCTACTTTTTTGAGGTAGGAAAAT
AATATCCATTAAATTATTTAGCTTATTTAGCAAGCAGGGTATAACATTTTTATTTTTAAT
TATTAATCTTTACATTTTTATTTCAAACAAATCACTTAGGCTTTAGTAAAATTTAAAGAA
AAATTCAGTTAGCCTTGTTACTAAATTTCTTTAAGTTATGTGTGCATAGAAGGATATGAA
AAAGAAAATATTTTTAGATAGCTTATTAGAAAGTCTCAAAGCAATATAATTAGCTACAAA
AAAAGGGCTTAAAATAGATATGAAAATAATAATTATGAAAATTATATCTTTTGCAGGTGA
TAATTCTTTTATTGATGAAGGTTTACTTTTAAGTAAATATTATTACTACCAATAAAAAAA
TCCTTCATGCTTTTACTACGAGTTTTCAAAAACAAATCCAAGATGGAACTTAACTGATTT
AGAAGCTGACATAATTAAGAGTACTGATGATCCAAAGGATAAAGAAAAGAATACATATGT
ATTGATTTCAAGAATTAAATTATTGTAGAGAACTGTTGGAGGATTTAGCAGTTACTATGA
AGAAACAAAATCTAATTTGTAACTCGCCTCTATTGTCATCAGTGAAAAAGACTCTTACTT
TAAAGATTATATATTCCTAACACATAAAATGATAATTAATGCACTCAAAGGAAATGAAAA
AATCGATTAAGGTACTATATGTTCATTTTACTTTTATCACCTAACTTAAGAGAATATTAC
AATAGATTAGTTTGGTGCTATGCTAGTAGATATACTCAATCTAAATAAATAAAATAGTTT
TTAAAAAAATATGATTCATTCTATAATAGTGGATTGTATATAACTCATATCCAACAAGAG
CTCAAAAAAAATATACACTTAGATTTTTGAAAATAAAATTGTTATAAATATGATAGAAGT
ACTGTGCTTTTAACTAGAAGACTTGTAATTAATTGAAAAAATTGCACTTTATTTGAGTGA
AATACCTTATAACTAAAAGATATAACATATAAGTATATTGTTAAAGATTTCTTCAGCATT
AAAAGAAGAAAAATAAGCAATTGAAGAAAATAATTTCTAAAAAAGCTAACTTTAATAAAA
ATAATAGTAGAAATAGTTATTCAAATATGAGTAATAGTAAAATTTAAATAATTTTTCATT
TAATAGTGACCAAGAAAGTATGACTATTGTTTAAGAGTAGCTATCACATAAGAATCAAAA
TACTAATGCAAGTTCATTATTTACTGTTACTTAACCACACATGAATAAAAATTAGAAAAG
TAATAATAATGGTAAGAGCAAATCAAGAAGAAGCAAGAGTAAATAGCGAATATCTAATAC
TTAATTAGAAAAAAATGAATAAATAAAATAAAATGACTAATTTGAAGATACGACTAATAA
CAATTATAATCAAAATGCTAATGCTAATATTGAAAATTAATACTTTGATAATAAGGAGAA
TATTTTTTAGGAGAATTTCATTTAAATCGCTGCACCTGCAAATGCCCTTCAATAGCAAGT
GGTTTTAAAAAAAATAAAAGAAGAAGATTAATTTTATAGATTGTGTGAAGACTACTAAGA
ACTCGATATAAAGGAAGTTGGAGGTATACAAGTAATGATGGCTTATAAGATTTTTAATTA
AATTTAAGACCTGAAAAATATTTATTTTAATAGCAAACTAAATAATCGAGAAATATTAAA
AGAATTAGAAAAACCCAAGTCAAATAGTATGATGTCTGACAGCACTGGTGCATAAAGAAA
AAATATTTAAAATGACATTATTGATTAAGATTTGTTAAATATATTGATTATTTAAAATGA
AATTTGTGAGCTGATTAATGAGTAAGAAATAAATCGCTAAGAGATTAGGTGCTAAAATTT
ATTCTATATATTCACTTTTTTTTTAAGTATGATAGAAGATTAAGATAATATTTATTTCAA
CTACAAAAGAAATAGAAGGAAAGGGGGAAATAGTGGTTACTAAGTTATTTCTGTTTAAAT
AAAGTTATTAGTTGAGGATATGTTTAAGTATCACAGATATTAGAATATTGATAAAATAGA
TTCTAAATCATCTAAAGGCAGATCTTTTAGAACTCTACCTGAATATAAACAAAAGATGGA
GGAGATTAGAAATTTTTAGATGAGCTATACAATTAAATGTTCTATAGCATTATTTAAGAA
TAACTTGGATATTCATGTATCATAAGATCTAGTTGATACTATAGTAGAAAATTTAGATTT
TGAGGATTTAGATTTAATTCATACACTAATTTTAGCATTCGCTTAGTAAGAAAATATAGA
TTTGAATAAAAAGCTTAGTATAGTTGCAGATAGGTCTATTGAGCTATTTATTTCAATGCA
TAACTTTTAAAATGATTGCTAAAACATCAAAGAAAGCTAACGATTAGTATCTAGCGTTTA
GAAAGAATAAAAAGCCATTTCAGATTTACAGAAACTTATGAAAAAGTTAGAATGTACCTG
TGTAATAAATTTAGTTTATTTACACCATGCATCTATAGATTAAAAAATAAGAAACTCTCA
TATAGTTTAATGCTTAAATAAAAAGCTCAATGAATTCAAAGAATGTGTTTTAAAAAATCA
AATCGATTCCTAGCAGTTGTATGTCTAAATAATGATGGAAACAGTCTGCAAATATATGTT
TAGTAAGAAAAAGAAAAGCTAATAACTGAAAAAGCTTAATTTATAAGGAGTTTTTGAAGA
AATAGGAAACAATTTTTCATAGATACTTTCTTGGAACGAAAAAAATCTTTTGGAACAATT
AGGTTTTTTTATTTAATACATGGAATTTAGTGATTTTTGCATTACATAAATGTAAAGAGA
TAAAAATGAATTTGGAACAGAAGAATCTATTGAAATGCAAAAAAATTTAAATATAATTAG
AAGAATGACAGTTAAAAATCTAGAGTCTTTTCATAATGTAGACAGTTTAGATGTCAGCAA
TGAAAAATGTTTTAATAAAGTGTTAATTCAAGTTTTGACAAAGATCGTTTAAATAATTAA
CACTAAATTTAACATTTAAAAGTCTGCACTGTAGATTAGCTTTAAAACTATTAACTTGAA
GCTTACTCTTATCAACAAAATTATTTGTTTAATATTAGAAAATAAACTAAAAGACACAGC
TTCAATATAAAATTTAACTGCAATATAAGTTCTCTATGAATCAAGCACATACTACAATTA
AATACTTTTAATGCTTTTAGAAATAAATGAAGACATATACTATATTTTGTAGCATAATAC
AGGCTCAAATTAATAGAATTGGGATTTATAACACACTCATTCATTTATAGTTAATTTTTT
ACTAGCTTCTGAAAACATCCAAGGGTCTCCCTTAATACCAAAATTCAATTTTTTAAGATA
AAATTTATCATGGAGAGAAGTTAAGCAGTTTTTACACACACTTAAGTATATAAGAGAATT
AGCTAGTTACTTTTAAGTTGGAATTTTGTAAGCAAATATTATTGTATTTGAATTACTATT
ATTGAGGTTTTTAAATTATGAAGGCTAGTTTTTGAAAAATACAACACTAGATTTTCATGA
AAAAGATTTCTCTGAACTATCTAGTGTATCTTAAGAGTATAGCATTGGTTTTTAAAGTGA
TAAGGATATAAAAGAAGATTCTTTTTTTAAGTTTATTGAATTGAGAATAGAAGAAAAGTT
GGAAGAATATATTTAGGTCCTCCATTAAAATTAGAAATCCGATGAAGCTAAAAAATTATT
AATCTACTCTAAAGCCAATTCAAAGATTGAAGATATTTAATCTTGGTTATAAGAAATATA
ACAATGCTTAAAACGCAAAAGAGTGAGCTGTGGAAAGCTTATAGAAAAAAATACTAATTA
AATAAAGTATATAATCCATGAAATTAACGTTCTTAGGATAGAAAACAACAAGATCGCTTC
ATTTTAACCAGACAATCTAAATGAATAAACAACTAAAATTCATTATAGAGATATCATGAA
GGAGGCAGATGAGATTGAAAATGAAATAGAGAGTTATGATAGAAATTCTATTTCTTCATA
AAATAAACAAATTCTAAAACTAGATTATATAGTATTAAGCCTAAGAATGCATATATATTG
CGCCTAGTATATCAGAAATAGCAATCAATCATATTTTTCTACTTAACTCATGGAGAAGGC
TTTTAAAAAGCTAACTTCGATTTGCTTTGAAAAGGCTGTAGGTAACTTAAGTGACATTTA
TGAAAACTATTCTCTTTAATAAGGCGCATGCTAAATGTACCATGCTGCAGCGAAGACTTA
ATAGGAGATAAGTGCTTAACAGTCACAAATAGGATTTATCATCAATCCCTTTACTAAAAT
TTAGACTTTAGTCAATAACAGGAAATACTCCTCAAGCAATAAAATATTAGGAGATTTAGT
AGAGTATCTGAACATAGGGAATGGCTTTTCTTACTTTAAAAATACAGGAAGCAAAAGAAT
ATAATAGCTGCTAATTCAATGCTTAAAATTATATTGCAAGAATTAAAATTCTTTAAATTG
CTTTAATAATCTTAAATATTATGGAAAGCTTTTACAAATAACTAGTATTAGATTCCTTGT
TTTGCATGAATTTTTAAGGATTTAGACTATTCTAAAGGACTACTCTGATTTCTTAAGAAA
CGGCGTTTTAATTGATATAATAGGTAATCTATTGTTATAAAAATAGTTTAATCTACAAAC
TCTTCATAATTTATTTAGCAAGCGTAAATCCAGTGTTATAAATATGTAACTCAGTAATTT
CATCTAGTCTCTAAATGATAAACTTTTAACATAAGATTTAGATTTAAGATCCACAAAAAT
GTATAAAATATCTATGCAATACATGATTTCCTTGTTTACCTCTTCAGTACGTATAAATCA
TAAAAACTTAGAGAGTGAAATTTGTGAAATGATATTTTTTTCAAAAAAGAAATTCTATTT
TCTCAATCCATAACTCCATCAAAATTTGTAAGAGAATTCTGAAATGTCAAGAAATGGAAG
TGTCGAAATAAATAAAAATAAGAAAATGATTTCGAGAAATCAGAATTAAATAAATGATTC
AAAACTAAATAAATTTCCTTCAGGAGTATGCTAATTATTTTATAATATTCTCTCTATCGA
TAAGAATAACTCAAAGTAATAAACTTATTTCATAGTAAATGAAGATTTTTGCTCCCATAT
TATATCTCATAAAAACTATTATTCATTTACATTGAGATACCTTACTTTAATGCAATCATT
AAACTTACTGAGTAAAATAACAGACTGCAGATTGAGCATGAGCGAAAACTCTAATTAAAG
TAAAAATCCAACAGTTTTATGTGACGAAATACATGGAAATTTTATAGCTTTAATTAATTT
TAGGTAGTTATGCCAGCTGATGCATAATTCTTATCTATAATATAATTTGACATATGCAAA
GCAATTCTTTTATCTTTATCATAAATTTGATGAAACTATAAAAGAGCTATTAAGAGAAAT
TCCATATCTAATATAAGTTTATTAAAATAATACAGTTGTAAAAAATTGTTCATGTTTGCC
TTCTTCCTAAGTTAAAGCTCCTTTGTTTTTGGATGGAAGCAGATAACTCATTACTGAATC
GTTTGCTCTTGATGCTTCGTACATGTATAAAAAAATGCTTGTTAATTCATAAGATTTATC
AGAGTAGTAAGATGCTATTTTGCTAGAATAAGAAAATTTTGAAGAACCAGATTCGAGCAT
GAAGCAGTCATCATCCATGTCAAGTGATTAAAGTGAATAAAAATTACAAAATTAGCAAAA
TAAAGTAAAATAAAAAAATAATCTAATGATGGATGAAACAGAAACAGCTATTAATTCTAA
ATAATTAGGGCAGTTTGAAAAGTTAAGCTCAGTAAATAGTATTTAGCAAGCTTAAATAAA
TTTTGAGTTCAAAAGATTGAGAACAAGTATGAGAGATTTTAGCATTAGCAAATATGCTAA
AAGTGACCTAACTTAAGTTTTATAAAAGTCTTTCAAATACAGCAGGATTGATAACTTTAG
CTAGAGGCATTATTAATTTTAACAAATAAAGTTAGAACATGATTTGATAATATTAAACTT
TATTGATTATAATAACGAAAGGGCAATTCAAATATCAAAGTTTAATCATCTTAACTAAAA
TTATTCTAATTTTAGAATTAATAGTCAATCTCAAACTAATTTATTTTCAGACTACATAAA
TGACATAAAAAGAATACTTCAAAATAATGAATCTGATATGAGAAACGATGAAAAAAAGCG
AAAGTCTTAAGTTGATCCAAATAACTGGTGGAAAAGTAGATATAGCAATGACAAATAACT
TGAGAAAATCCTTAGCCAAACTCAAACCATTCTTGACTATCACATAGTAAATTTTTATTT
TTAGCTTCTAATTTTTTAATATATTTAATTTATAAAAGTTTTTGTTCTTTGGAAGTGAAT
AAACAGAAAGAGAAAAAAAAATAATGTAAGATATTTTAGTAAGGATAAACTAATGTGAAT
AAATATGCATAGCTAATTAACCAAATGATCAATGTTCTTTATTTGAAAAGCATATTTTAA
TTCAAGAAAAAAATAATTTAATAGAGCTGTTATTCTCTTTGATTAAATGTTCTTTGTTTA
TAACTTTGAACTAAACAAAATTAAAGCTCATTTTTGAGTTGATGTGCATTCAAAATATAT
ATTTGTAATACTTAGGTTTTCAATCTTAGCAATAACTTTTTTCAGAGGTATCAATTTTTT
TTAGCTTTCACATGATTAAATCAATGAGTATTTTTACAAATTTAAAAGATTTGCAAACTA
TAAAATGAGTACTAAAAAAGCTATAATCCTTCATAAAGAAAACCAATGATGTGGATTCTA
AGTGAAAATCTTTTACAGGCACCTTTAGAATTTATGAACTGCTTTTCTGAAAATAATTAA
ACTTTCTATAGAATACCCTCTTTATAATACCTTTATGAGAAGTATAATTTATTTTTTATT
AAAATAAAATATTTAATCCTATTTCAATTTAGTTACACCCCTAATAACAGTGTAAATTTC
TCTAATAATTATTATTTACTAAACCCTTCTGGAGATCTGGTTCATACTTAATCTAAATTC
TAACATAAATTTGAGTCGTAATATTTAAATTAAATTTAATTTAAAAATTTTATCTTTTAT
TTATTCTAAACCAGGATAAGGTCATGGGAAGGTGCTAGTGGATTTAGTGTAAGTACTAAA
GAACTCTAAAAAGTACTTAAAAATTATCAATCGTATACATACATCGGACATGGGGCAGGA
GAGCTCTATATAAATCAAAAGCAAATTTAAGAAATAAAAAACATAAAATCTGCTATTTTG
CTATTTGGTTGTCAATCAGCTAGATAAGCTGTGTAGTTAGAATTTAACTCTCATTAATAC
GAAGTTACAGGAAATAGCTTATACTTTTTAATGAATAATTGTAAAGTCCTTATTGGGAGT
CTTTGGGATATAACAGATAGAGATACTGATAGGATGGTTTTAAAATTAATTTAAATTATT
GAAAAAGCTAGTTTGAAGAAACCTATTGATTTTAGCTAAGCATTTTTACAGTCGAGAGAG
TAATTTTATAAATATTTGTTTTCTAAAATAATTAATGTTTTTTAATAATTAAAGGGAATG
TAAACTAAAATGGCTTAATGGATCATCATTTGTTTGTTTTGGAATCCCAACTTAATTCCA
CATGAAATGA