Identifiers and Description

Gene Model Identifier

TTHERM_00420680

Standard Name

ERS5 (glutamyl-tRNA Synthetase 5)

Aliases

PreTt07193 | 46.m00248 | 3679.m00098

Description

Glutamyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR00463 ) glutamyl-tRNA synthetase
  • ( TIGR00464 ) glutamyl-tRNA synthetase
  • ( TIGR00440 ) glutaminyl-tRNA synthetase
  • ( PF07783 ) Protein of unknown function (DUF1621)
  • ( PF00749 ) tRNA synthetases class I (E
  • ( PF03950 ) tRNA synthetases class I (E

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00420680

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11010.19.997093137033517e-262glutamyl-tRNA synthetase (2519
aa)
SGDYGL245W2.0005951135209932e-158GUS1 Glutamyl-tRNA synthetase
(GluRS), forms a complex with
methionyl-tRNA synthetase (Mes
1p) and Arc1p; complex formati
on increases the catalytic eff
iciency of both tRNA synthetas
es and ensures their correct l
ocalization to the cytoplasm
OxytrichaContig21938.0.g182.9992103642374242e-151tRNA synthetases class I (E an
d Q), catalytic domain
WormBaseWBGene000013371.0001788721085356e-149locus:ears-1 status:Confirme
d UniProt:Q23315 protein_i
d:CAB00060.1
DictyBaseDDB_G02874679.998173848842182e-134gluS on chromosome: 5 position
295392 to 297778
Stentor CoeruleusSteCoe_295431.8048513878454153e-35

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00420680(coding)
ATGCAACACTCAAAAGGTTTTAATCTAGAAGAAGAATATAAGAAGTATAAGAACGTCCTT
AAGGGAGCAAAGGAAGGAGAAGTCGTTACTCGTTTTCCTCCTGAGCCTTCTGGTTACTTG
CATATTGGTCACGCTAAGGCTGCCTTGATCAATTATCATTATTCATAAATTTACAAGGGT
AAAATGATCTTCAGAATCGATGATACCAATGTTGAAAAGGAAAAGGATGAATATGTTAAC
TCAATTATTGAAGATTTAAAGACTTTAGGCGTAAAATGGCATGGTGATATCACTCACACT
TCTGACTATTTCGACTATTTGATCGAAAAAGCTGAAGAATTAATCAAAGAAGGTAAGGCT
TATTGTGATCCTACTCCTGTTGATTAAATGAGAGATGAAAGATTAAAGATGGTAGAAAAT
GCCTACCGTAGTACTACCCCTGAAGAAAATCTCAAGATTTTCAGAGCTATGTGCTAAGGA
CCCGTTGATGGAGTCGAAGAAGTTAAAAATGCTGATGACTACTGTTTGCGTGCAAAAATC
GATATGAAGAGTCCAAATGGCTCTTTGAGAGACCCTGTTTTATTCAGAGTCAACGTTAAG
CCTCACCACCGTACTGGAACCAAGTACAGATGTTATCCTACTTATGATTTCTGTTGTCCT
CTTGTTGATAGCAAAGAAGGAGTTACTCATGCTATGAGAAGTAACGAATACTCTGATAGA
ATTCCCTAATATAACTGGGTCCTCTAAGCTTGTAAAGTTAGACCTGTTACCATTTTTGAA
TTTAGTAGATTAAATTTATAATACACTTTACTTTCTAAGAGAAAACTCTAAGAATTTGTT
GATAAGAAAGTAGTTGAAGGATGGGATGATCCTCGTTTCCCTACTGTCAAGGGTATCATC
AGAAAGGGTTTGACTGTTGAAGCTTTGACTGAATTTATGTTAGCCTAAGGTCCTTCTAAG
AATACCAATTTGATGGAATGGGATAAGATATGGTCAATCAACAAGTCTATCATCGATCCT
TTATCTGGAAGATTCTCAGCTCTTTCTTCTAAAAATCTTTCCACCGTTGAAGTTACTAAT
GTTCCTGCTGGTCACGTAGAACCTGTTGAAACTCCTCTTCATCCTAAGGAAGATCTTGGT
AAGAAAGTTATTTTCTAATCCAGTAAGCTTTTGATTGATTACGAAGATGCTGCTGCTCTT
GAAAAAGATTAAATCGTTACTTTCATGAAGTGGGGTAACTTCAAGATCTTAGAAGTTGTT
AAGCCTGAAGCTGGACCTGTTGCTGTTAAGGCTGAATTCCTTCCTGATAACAAGGACTTT
AAGAAGACTGTCAAGCTTAACTGGATTGCAGACGTTGATACTGTTAAACTAATTTTAGTT
GAATATGATCATTTACTCAGAGAAAAGAAATTATTGGAAGAAAAGGAAATGCCTTTCGAA
AAATAATTAAACGAAGTAACTAAGTACGTTACTGATGCTATTGGTGAAACTGCTCTTAAG
GATGTTAAGCTACACTAATACATCTAACTTGAAAGAAGAGGATACTACAAGGTTGATAAA
ATCCATGAAATAGATGGTAATAAGGTTCCTGAATTAATTTATGTTCCTGATGGAAAAACT
AAGCCTGTCATAATTAAATAAAATTTTCTTAAATCCCATACTTTATTAAACTTTTGA


>TTHERM_00420680(protein)
MQHSKGFNLEEEYKKYKNVLKGAKEGEVVTRFPPEPSGYLHIGHAKAALINYHYSQIYKG
KMIFRIDDTNVEKEKDEYVNSIIEDLKTLGVKWHGDITHTSDYFDYLIEKAEELIKEGKA
YCDPTPVDQMRDERLKMVENAYRSTTPEENLKIFRAMCQGPVDGVEEVKNADDYCLRAKI
DMKSPNGSLRDPVLFRVNVKPHHRTGTKYRCYPTYDFCCPLVDSKEGVTHAMRSNEYSDR
IPQYNWVLQACKVRPVTIFEFSRLNLQYTLLSKRKLQEFVDKKVVEGWDDPRFPTVKGII
RKGLTVEALTEFMLAQGPSKNTNLMEWDKIWSINKSIIDPLSGRFSALSSKNLSTVEVTN
VPAGHVEPVETPLHPKEDLGKKVIFQSSKLLIDYEDAAALEKDQIVTFMKWGNFKILEVV
KPEAGPVAVKAEFLPDNKDFKKTVKLNWIADVDTVKLILVEYDHLLREKKLLEEKEMPFE
KQLNEVTKYVTDAIGETALKDVKLHQYIQLERRGYYKVDKIHEIDGNKVPELIYVPDGKT
KPVIIKQNFLKSHTLLNF


>TTHERM_00420680(gene)
ATGCAACACTCAAAAGGTTTTAATCTAGAAGAAGAATATAAGAAGTATAAGAACGTCCTT
AAGGGAGCAAAGGAAGGAGAAGTCGTTACTCGTTTTCCTCCTGAGCCTTCTGGTTACTTG
CATATTGGTCACGCTAAGGCTGCCTTGATCAATTATCATTATTCATAAATTTACAAGGGT
AAAATGATCTTCAGAATCGATGATACCAATGTTGAAAAGGAAAAGGTAAATTAAACAATA
ATTTTAATTAGGATTAGCAGGAAAGCACAATAATTTAGGTTATATTAGAAGGAAAATTTA
AAATTTGCTGATTATTTTAAATTAGTAAATATTATTTTAAATCTAAACTATTTATATAAT
TAGGATGAATATGTTAACTCAATTATTGAAGATTTAAAGACTTTAGGCGTAAAATGGCAT
GGTGATATCACTCACACTTCTGACTATTTCGACTATTTGATCGAAAAAGCTGAAGAATTA
ATCAAAGAAGGTAAGGCTTATTGTGATCCTACTCCTGTTGATTAAATGAGAGATGAAAGA
TTAAAGATGGTAGAAAATGCCTACCGTAGTACTACCCCTGAAGAAAATCTCAAGATTTTC
AGAGCTATGTGCGTAATAGATTAAATTAATATTTCATGGAGCTCATTTTAAAAATTCTTA
ATTATTCATTTATTAGTAAGGACCCGTTGATGGAGTCGAAGAAGTTAAAAATGCTGATGA
CTACTGTTTGCGTGCAAAAATCGATATGAAGAGTCCAAATGGCTCTTTGAGAGACCCTGT
TTTATTCAGAGTCAACGTTAAGCCTCACCACCGTACTGGAACCAAGTACAGAGTAAACAA
TAAATACAGAAATATATATATATTTATATTTATATAAAAATAAATAATTTTTATGTATTT
TATTTAAAAAGTGTTATCCTACTTATGATTTCTGTTGTCCTCTTGTTGATAGCAAAGAAG
GAGTTACTCATGCTATGAGAAGTAACGAATACTCTGATAGAATTCCCTAATATAACTGGG
TCCTCTAAGCTTGTAAAGTTAGACCTGTTACCATTTTTGAATTTAGTAGATTAAATTTAT
AATACACTTTACTTTCTAAGAGAAAACTCTAAGAATTTGTTGATAAGAAAGTAGTTGAAG
GATGGGATGATCCTCGTTTCCCTACTGTCAAGGTAAATTTTTATTTTGGGCAATCCTTTA
TTAATTATGCAAAGAAAATATTTTTTAGATAATATTTAAATTTTCTTTATAAAATACTCT
AAATGTTTTTTATTTTACATTTATTTATGAATTTTTTATAAAAATAATGAATAATCAACT
TATAAAATTTAATATAGGGTATCATCAGAAAGGGTTTGACTGTTGAAGCTTTGACTGAAT
TTATGTTAGCCTAAGGTCCTTCTAAGAATACCAATTTGATGGAATGGGATAAGATATGGT
CAATCAACAAGTCTATCATCGATCCTTTATCTGGAAGATTCTCAGCTCTTTCTTCTAAAA
ATCTTTCCACCGTTGAAGTTACTAATGTTCCTGCTGGTCACGTAGAACCTGTTGAAACTC
CTCTTCATCCTAAGGTAATTTTTAATAAAAATAAATCTTGGTCTAAAAGTAATTTAAAAA
TATTAGGAAGATCTTGGTAAGAAAGTTATTTTCTAATCCAGTAAGCTTTTGATTGATTAC
GAAGATGCTGCTGCTCTTGAAAAAGGTAAAATAAATAAATATATTAGTTAACATTAAAAT
AATAATTTATTTATTATATTTAGATTAAATCGTTACTTTCATGAAGTGGGGTAACTTCAA
GATCTTAGAAGTTGTTAAGCCTGAAGCTGGACCTGTTGCTGTTAAGGCTGAATTCCTTCC
TGATAACAAGGACTTTAAGAAGACTGTCAAGCTTAACTGGATTGCAGACGTTGATACTGT
ATAAAAATAATATTTTTTTAAATATATTTTTTAATTAAATTTTAATAAAAATTAATAAAG
GTTAAACTAATTTTAGTTGAATATGATCATTTACTCAGAGAAAAGAAATTATTGGAAGAA
AAGGAAATGCCTTTCGAAAAATAATTAAACGAAGTAACTAAGTACGTTACTGATGCTATT
GGTGAAACTGCTCTTAAGGATGTTAAGCTACGTAAATATTTTCATTAAAATTGTTTAAAT
TAAAAATTTTTTACATATATTTAGACTAATACATCTAACTTGAAAGAAGAGGATACTACA
AGGTTGATAAAATCCATGAAATAGATGGTAATAAGGTTCCTGAATTAATTTATGTTCCTG
ATGGAAAAACTAAGCCTGTCGTAAGATACAAAATTTAAAAAGCAAAAATAAATTTATTAA
TTGAAATATTAGGGTAAGTGATCAGCATAATACAAATAAGAACAAGAAGAAACAAAAAAA
ACTATTTAAACCATCAAATAAAATATCTAAAATATGTTATATGTTTTTTTTATTTTAAGT
TAGATAATTAAATAAAATTTTCTTAAATCCCATACTTTATTAAACTTTTGA