Identifiers and Description

Gene Model Identifier

TTHERM_00721810

Standard Name

ERS4 (glutaminyl-tRNA synthetase 4)

Aliases

PreTt18489 | 115.m00145

Description

glutaminyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR00463 ) glutamyl-tRNA synthetase
  • ( TIGR00464 ) glutamyl-tRNA synthetase
  • ( TIGR00440 ) glutaminyl-tRNA synthetase
  • ( PF00749 ) tRNA synthetases class I (E
  • ( PF03950 ) tRNA synthetases class I (E
  • ( PF04558 ) Glutaminyl-tRNA synthetase, non-specific RNA binding

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00721810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_84440
Tetrahymena borealisEI9_17428.19.997093137033517e-262glutaminyl-tRNA synthetase (81
0 aa)
DictyBaseDDB_G02894819.997316819378982e-180glnS on chromosome: 5 position
2857147 to 2859666
OxytrichaContig21385.0.g179.997316819378982e-180tRNA synthetases class I (E an
d Q), catalytic domain
WormBaseWBGene000013361.0004236668521093e-146locus:qars-1 status:Partiall
y_confirmed UniProt:D3YT95
protein_id:CBK19497.1
SGDYOR168W2.0006597401342834e-129GLN4 Glutamine tRNA synthetase
, monomeric class I tRNA synth
etase that catalyzes the speci
fic glutaminylation of tRNA(Gl
u); N-terminal domain proposed
to be involved in enzyme-tRNA
interactions

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00721810(coding)
ATGTTCAGAAGACTTTTTCAAACTTAGAAATATGCTAATAAGTTTTATTATAAAATATAC
TAGGGATTCAGTAATGTATTGTTTTAGCGCTTTTAATTGATAGGTGTCAGTAAAAATTTC
ATTGAGTAAGCTGAGAAAAGCAAACAAGTTTCGAATCATCTAGAAGATTTGCATCAGAAA
TATAAAGAATCCATTTATGCAAACAAAAAGAAAGCCAACTTAATTATTAGTTTATCAAGC
AAATTGACACCTACTCTAGAATCATATAAGTATGAATTGGCTTAATATATAATTAACGAA
TAAATTAACTCAAATGCTGATTTAGACAAGGCTTTAGCATATGTTAAAGATTATGCTAAA
AAGAATAATCAATTAGATTGGAAATAATTCGAGTAGACATTAGGACTAGGGATATAGATA
GACGAATCATAAGTTATTTCAGATATAGTAACAGAGCTTAACTCTATACCTAACTTAAAC
AAGGAATTACTGTGCTCTGATAAGAAATATTCCTCTTAGAATTTAAGAGTAGTAAGAGAT
AAGCTTAAATAGCATGAAAGCAAATTAATATTTTAATGTTTTGACAAAGCAGTTTAGTAG
TTTATTGAAAATTAAGAGAAAAACACTAATTAATAAGGGGCGTAAGACAAAGATGGAGTA
ATTCATTCAAGCTAAGGAAATAGTATCTTTATTAAGGAAGACCTTTAAACTCATATTTGG
GATAAAATAGCTTCTTTAAAAGGTCGTGACTTATGCTATGAAAATAACAGTAAGTAGGCT
TATGAAAAACACTTAAAAGAAAGAAATGGATATTAATATATTTTCAGATTTCCACCTGAG
CCTAATGGATATCTTCATTTGGGGCATGCAAAAGCATTAAGAACAAATTTCTATTCTGCT
GAAAAGTTAGGAGGAGTTTGCTATTTGAGATATGATGACACAAACCCAGAAAAGGAAAAA
TTAGACTATATTGAAAGCATAAAAGATAATGTTTTATGGTTTGGATTCAAACCTTATAAC
ATAACATACTCTTCAGACTATTTCTAAGAAATATATGAGTGCGCTATCAAGCTCATTAAT
AAAGGATTAGCCTATGTTTGTGAGTTGTCATAAGAGCAGATGGCAGAATTGAGATAAAAT
AAATAGGCCTCTCCTTACAGAAATAGGAGTATAGAAGATAATTTGAGAATGTTTGAAGAC
ATGAAATAAGGGAAATATAAAGAAAATGAAGTCTGTTTGAGAATGAAAATTGATTATTAA
CATCCTAACCCAACTATGAGAGACCCTGTTATGTATAGAGTTAAATATCATCCCCATCCT
AAGACTGGTAAAAAATGGTGCATTTATCCAATGTATGATTTTACTCACTGCCTATGTGAT
TCATTTGAAAATATTACTCATTCTCTTTGTACTCTTGAATTTGAGATTAGAAGAGATCTT
TATTATTGGATTCTAGATTCACTTGATTTGTATAAGCCTGTTGTCTGGGAGTATTCTCGT
CTGAATGTCTCAAATAGTGTTTTAAGTAAGAGAAAACTTTTGACCTTGATTAACAATAAA
GTAGTAGATGGATGGGATGATCCTCGTCTGTTGACAATCAATGCTCTTCGTAGAAGAGGT
GTCAGACCAGAAGCAATTAGTGCATTTGTAGATTTAGTAAATGTAGCTAGAAGAGGTAAT
GAAAATATTATCGATCAGAAGCTTTTAGATTATTGTATTCGCTAGGATTTAGAAAATATT
TCCCCCAGAACTATGTCCATATTAGAACCTATCAAATTACAAATAATTAACTTTGATGAT
TTTAATGTAAAACAAGTTAAAGTTCCTCTCTTCCCTAAAGAACCTAATAGAGGATTTAGA
GAATTAAACATTTCATCCGAGTTGCTGGTAGATGCTTCTGATGTCAGAGAAAGTGAACCA
AATAAAAAATAAGAAGATCACTAAAATTTATAAAAAAAGAGCACTAAAAAGGTGGATAAA
AATACATTCATAGGAATCTATCCTGGTTCTTAGATAGCACTTAAATACTTTGGAGTTATT
GAGATCATAAGTGTAAATATGCAAGAAAAAGTAGTTAAAAGCAGATTGATATCTACTGAA
GAAAAAGAAAGAAGAGAGGCTATAGGGTAAATACATTGGATTAATCCCCAGGAAGCAGTT
TAATGTTAAGTAAAAGTATATAATGATCTATTCACTGTGGCAGATCCTAATCAGTTCGAT
AATATTCTAGATGCAGTAAACCCTAACAGCTTAGAAGAGTACAATAATGCTTATATTAAC
AAGGACTTAATTAACTTGTCAAAAGAATATAAAACATTCTAATTTGAGAGAGTGGGTTAT
TTCACACTTGACCAAACTTCAGATATTTAAGAAAATAAAATACGCTTTAACAGGACAGTG
AGCTTAAAAGATAGAGTCAATAGATCTAATTTATGA


>TTHERM_00721810(protein)
MFRRLFQTQKYANKFYYKIYQGFSNVLFQRFQLIGVSKNFIEQAEKSKQVSNHLEDLHQK
YKESIYANKKKANLIISLSSKLTPTLESYKYELAQYIINEQINSNADLDKALAYVKDYAK
KNNQLDWKQFEQTLGLGIQIDESQVISDIVTELNSIPNLNKELLCSDKKYSSQNLRVVRD
KLKQHESKLIFQCFDKAVQQFIENQEKNTNQQGAQDKDGVIHSSQGNSIFIKEDLQTHIW
DKIASLKGRDLCYENNSKQAYEKHLKERNGYQYIFRFPPEPNGYLHLGHAKALRTNFYSA
EKLGGVCYLRYDDTNPEKEKLDYIESIKDNVLWFGFKPYNITYSSDYFQEIYECAIKLIN
KGLAYVCELSQEQMAELRQNKQASPYRNRSIEDNLRMFEDMKQGKYKENEVCLRMKIDYQ
HPNPTMRDPVMYRVKYHPHPKTGKKWCIYPMYDFTHCLCDSFENITHSLCTLEFEIRRDL
YYWILDSLDLYKPVVWEYSRLNVSNSVLSKRKLLTLINNKVVDGWDDPRLLTINALRRRG
VRPEAISAFVDLVNVARRGNENIIDQKLLDYCIRQDLENISPRTMSILEPIKLQIINFDD
FNVKQVKVPLFPKEPNRGFRELNISSELLVDASDVRESEPNKKQEDHQNLQKKSTKKVDK
NTFIGIYPGSQIALKYFGVIEIISVNMQEKVVKSRLISTEEKERREAIGQIHWINPQEAV
QCQVKVYNDLFTVADPNQFDNILDAVNPNSLEEYNNAYINKDLINLSKEYKTFQFERVGY
FTLDQTSDIQENKIRFNRTVSLKDRVNRSNL


>TTHERM_00721810(gene)
ATGTTCAGAAGACTTTTTCAAACTTAGAAATATGCTAATAAGTTTTATTATAAAATATAC
TAGGGATTCAGTAATGTATTGTTTTAGCGCTTTTAATTGATAGGTGTCAGTAAAAATTTC
ATTGAGTAAGCTGAGAAAAGCAAACAAGTTTCGAATCATCTAGAAGATTTGCATCAGAAA
TATAAAGAATCCATTTATGCAAACAAAAAGAAAGCCAACTTAATTATTAGTTTATCAAGC
AAATTGACACCTACTCTAGAATCATATAAGTATGAATTGGCTTAATATATAATTAACGAA
TAAATTAACTCAAATGCTGATTTAGACAAGGCTTTAGCATATGTTAAAGATTATGCTAAA
AAGAATAATCAATTAGATTGGAAATAATTCGAGTAGACATTAGGACTAGGGATATAGATA
GACGAATCATAAGTTATTTCAGATATAGTAACAGAGCTTAACTCTATACCTAACTTAAAC
AAGGAATTACTGTGCTCTGATAAGAAATATTCCTCTTAGAATTTAAGAGTAGTAAGAGAT
AAGCTTAAATAGCATGAAAGCAAATTAATATTTTAATGTTTTGACAAAGCAGTTTAGTAG
TTTATTGAAAATTAAGAGAAAAACACTAATTAATAAGGGGCGTAAGACAAAGATGGAGTA
ATTCATTCAAGCTAAGGAAATAGTATCTTTATTAAGGAAGACCTTTAAACTCATATTTGG
GATAAAATAGCTTCTTTAAAAGGTCGTGACTTATGCTATGAAAATAACAGTAAGTAGGCT
TATGAAAAACACTTAAAAGAAAGAAATGGATATTAATATATTTTCAGATTTCCACCTGAG
CCTAATGGATATCTTCATTTGGGGCATGCAAAAGTAATTTTTTAAAAGAACATTAAAATT
AATGTCTAAACCTATTTCATGAAAATCATACTAAAGATTTTTTTTAATTTAAAAACTTCA
TACTAAGAAGATTAAATCTTGCAAATCTAAGTATCATAAGCTATTTTTCTAAAATATCAT
TTTAACTTTAAAACTAAGAAAAACTTTAATGGATGAAATCTAAATAGTTTTAAATAAAAA
AACCTTTATTTTATCTATAATTTAAATAAAAACATTAAATTTCTTATTTTTATGAAATTA
ATTATAAAAAATAAAGCAAAAGTCCTCAATATTTTTACTTAATTTAAAAAATCTAAATAA
TTTTTTCATCAATTTTTAAATAATTTTAATTTTAAAATTTCAATAAATTAAATAAAAATT
TAAAATAAGAATAAGAAGCCTAATTTGTTTTGAGCAATCCGTAATCAAATATTTAATTTA
TAATTTTAATTAATTTGCTTAAAAAAGTTTATTTTTTTTTAATAATTTGTAAAAATTTTG
ATTCAAATTTTTCATGATTTAATTCAAATAATCTTATTCAATTTATATAATTTAAATAAA
TTTTACTTTGATTGAATAAAATACCTAAATTTATTAAATAAATTATTAGATTTGTTGGTA
TTTTGTAATATTCAAAGAATTTAGAATATTAAATTACATTTTAAGATTATTTATTAAAAT
GTTAAAATGTATTTTATTTTTAAATAATTAAATTAGGCATTAAGAACAAATTTCTATTCT
GCTGAAAAGTTAGGAGGAGTTTGCTATTTGAGATATGATGACACAAACCCAGAAAAGGAA
AAATTAGACTATATTGAAAGCATAAAAGATAATGTTTTATGGTTTGGATTCAAACCTTAT
AACATAACATACTCTTCAGACTATTTCTAAGAAATATATGAGTGCGCTATCAAGCTCATT
AATAAAGGATTAGCCTATGTTTGTGAGTTGTCATAAGAGCAGATGGCAGAATTGAGGTTT
AATTTTTAAAAATAATTAATATATATTAAATTATTATTTTTAGATAAAATAAATAGGCCT
CTCCTTACAGAAATAGGAGTATAGAAGATAATTTGAGAATGTTTGAAGACATGAAATAAG
GGAAATATAAAGAAAATGAAGTCTGTTTGAGAATGAAAATTGATTATTAACATCCTAACC
CAACTATGAGAGACCCTGTTATGTATAGAGTTAAATATCATCCCCATCCTAAGACTGGTA
AAAAATGGTGCATTTATCCAATGTATGATTTTACTCACTGCCTATGTGATTCATTTGAAA
ATATTACTCATTCTCTTTGTACTCTTGAATTTGAGATTAGAAGAGATCTTTATTATTGGA
TTCTAGATTCACTTGATTTGTATAAGCCTGTTGTCTGGGAGTATTCTCGTCTGAATGTCT
CAAATAGTGTTTTAAGTAAGAGAAAACTTTTGACCTTGATTAACAATAAAGTAGTAGATG
GATGGGATGATCCTCGTCTGTTGACAATCAATGCTCTTCGTAGAAGAGGTGTCAGACCAG
AAGCAATTAGTGCATTTGTAGATTTAGTAAATGTAGCTAGAAGAGGTAATGAAAATATTA
TCGATCAGAAGCTTTTAGATTATTGTATTCGCTAGGATTTAGAAAATATTTCCCCCAGAA
CTATGTCCATATTAGAACCTATCAAATTACAAATAATTAACTTTGATGATTTTAATGTAA
AACAAGTTAAAGTTCCTCTCTTCCCTAAAGAACCTAATAGAGGATTTAGAGAATTAAACA
TTTCATCCGAGTTGCTGGTAGATGCTTCTGATGTCAGAGAAAGTGAACCAAATAAAAAAT
AAGAAGATCACTAAAATTTATAAAAAAAGAGCACTAAAAAGGTGGATAAAAATACATTCA
TAGGAATCTATCCTGGTTCTTAGATAGCACTTAAATACTTTGGAGTTATTGAGATCATAA
GTGTAAATATGCAAGAAAAAGTAGTTAAAAGCAGATTGATATCTACTGAAGAAAAAGAAA
GAAGAGAGGCTATAGGGTAAATACATTGGATTAATCCCCAGGAAGCAGTTTAATGTTAAG
TAAAAGTATATAATGATCTATTCACTGTGGCAGATCCTAATCAGTTCGATAATATTCTAG
ATGCAGTAAACCCTAACAGCTTAGAAGAGTACAATAATGCTTATATTAACAAGGACTTAA
TTAACTTGTCAAAAGAATATAAAACATTCTAATTTGAGAGAGTGGGTTATTTCACACTTG
ACCAAACTTCAGATATTTAAGAAAATAAAATACGCTTTAACAGGACAGTGAGCTTAAAAG
ATAGAGTCAATAGATCTAATTTATGA