Identifiers and Description

Gene Model Identifier

TTHERM_00471840

Standard Name

ERS2 (glutamyl-tRNA synthetase 2)

Aliases

PreTt22592 | 56.m00296 | 3686.m00139

Description

glutamyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00471840

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11261.19.997093137033517e-262glutamyl-tRNA synthetase (552
aa)
OxytrichaContig17568.0.g762.0003615238957836e-139tRNA synthetases class I (E an
d Q), catalytic domain
DictyBaseDDB_G02719063.0012863295830206e-118mgluS on chromosome: 2 positio
n 1062208 to 1063962
SGDYOL033W1.999745369828301e-106MSE1 Mitochondrial glutamyl-tR
NA synthetase, predicted to be
palmitoylated
WormBaseWBGene000013382.000341663036036e-86locus:ears-2 status:Confirme
d UniProt:O44413 protein_i
d:CCD73973.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00471840(coding)
ATGCTAGCTTTAAAGATTCTAAGAACTTTCTCTGTATAGTAAAAGCAAAAAGTCAGGGTA
AGGTTTGCTCCTTCCCCTACAGGTTCTCTCCATTTAGGAGGATTGCGTACAGCTCTTTTC
AATTATTTATTTGCAAAAAAGAATAAAGGTCAATTTATTTTGCGTATTGAAGATACAGAT
CAAAAAAGGTATGTTCCTGGCTCAGTTGAAAACATTATCAAGAATTTATAGTACTTTTAG
TTGGAATGGGATGAAGGTCCTGGAGCTCATGGAAAAAACAACTTAAACGATTATGAAAAT
TAAGGACCCTTCGGTCCTTACTTTTAATCTTAAAGACTATAATTATATTAAAAGTATATT
AAGGAATTAATTTAAAATGGAGATGCATACTACTGCTTTTGTGATTCAAATAGATTAGAA
AAGCTTAAAAATGATTAGATTGAAAAGAAGTTGCCTTAAAAGTATGATGGACACTGTAGA
CATTTGACTGATGAACAGATTCGTATTAAACTGTTAAAAGGAGAAAAATACACAATTCGT
TTAAAAGTTCCTGAAGGAGAAACTACTTTCAATGATATAATACATGGAAAGATTACTATT
AATAATTCTTAAGTAGATGATTAAATTTTAATTAAATCTGACGGATTTCCAACATATCAC
CTAGCTAATGTTATTGATGATTATTAAATGAAAATATCTCATGTAATTAGAGGTCATGAA
TGGATAACTTCTACTCCTAAGCATCTTATATTATACGATGCATTAAATATTAAACCTCCC
AAATTTGCTCATATCCCTTTGCTAGTTAAAAAAGGTGGGGCTAAACTATCTAAAAGAGAT
TAAAGTTCTAGCGTTGACTTCTTTAGAGAAAATGAGTATTTACCAGAAGCTGTGAACAAT
TTTGTTGCTCTTTTAGGCTGGTATCCTAAATTTTTAGAAGATAGTTAAACTCTAAATGAG
AAGTTTAGTCCTAAGGAAGAAGTGCTTGATATGAGTGAAATGGCTGCTTTATTTTCTCTT
GAAAGAGTTAATCCATCAAACAGCTAGGTTGATGAAAAAAAATTAATTTTTTTGAATGGT
TAACATTTACAAATAAAATTTAGAGATGTTAGGATTGAAAAAGAGCTATAAAATGAATTT
ATGGATAAGATGGTTCAATATATTTAGATAGATAATTTAAAGTAAAAAATTTAAAGCTTC
AATACTGAAGATTAGCTATTAATGATAGAAACTATTAGAGATAGAATATAATTATATTCC
GAGATATCATAGTTTAAATACCTTTTTGAGCAACCTGATTATAAAAATGATAATTCATAA
AAATCTATTCAAAAAGTTGTTAAAAGTCTAAAAAATGCTAATAAAGTAATCAAAGACTTT
AAGGAAATTTTTGCAAGTCTTCACAATTAAAATAAATTTGAAATGACTTCATTGAGCAAG
GCGATGAGCTAATATCTATTTGATAATAATCCTCAAATAAAAAATGAAGATGTTTACCAT
TTTTTGAGATTAGCTATGTCTGGTTCTCACTAAGGACCTTCTACTGCAACAATTTGTCAT
TTACTTGGGTATTAAAATGCATTAGAAAGACTTAATTATTTTGAAGAAAATGTTCTTTCT
AACATAACAGAAGTAGAAGTTGAAAAATAAGTTTGA


>TTHERM_00471840(protein)
MLALKILRTFSVQQKQKVRVRFAPSPTGSLHLGGLRTALFNYLFAKKNKGQFILRIEDTD
QKRYVPGSVENIIKNLQYFQLEWDEGPGAHGKNNLNDYENQGPFGPYFQSQRLQLYQKYI
KELIQNGDAYYCFCDSNRLEKLKNDQIEKKLPQKYDGHCRHLTDEQIRIKLLKGEKYTIR
LKVPEGETTFNDIIHGKITINNSQVDDQILIKSDGFPTYHLANVIDDYQMKISHVIRGHE
WITSTPKHLILYDALNIKPPKFAHIPLLVKKGGAKLSKRDQSSSVDFFRENEYLPEAVNN
FVALLGWYPKFLEDSQTLNEKFSPKEEVLDMSEMAALFSLERVNPSNSQVDEKKLIFLNG
QHLQIKFRDVRIEKELQNEFMDKMVQYIQIDNLKQKIQSFNTEDQLLMIETIRDRIQLYS
EISQFKYLFEQPDYKNDNSQKSIQKVVKSLKNANKVIKDFKEIFASLHNQNKFEMTSLSK
AMSQYLFDNNPQIKNEDVYHFLRLAMSGSHQGPSTATICHLLGYQNALERLNYFEENVLS
NITEVEVEKQV


>TTHERM_00471840(gene)
ATGCTAGCTTTAAAGATTCTAAGAACTTTCTCTGTATAGTAAAAGCAAAAAGTCAGGGTA
AGGTTTGCTCCTTCCCCTACAGGTTCTCTCCATTTAGGAGGATTGCGTACAGCTCTTTTC
AATTATTTATTTGCAAAAAAGAATAAAGGTCAATTTATTTTGCGTATTGAAGATACAGAT
CAAGTAAAGTATTTGTATATTATGATTATTTTTATTGCTTTAATAATTTAAAAATATCAT
TAATTTGAAAGCTGTTGATATGTAAAAAACATAATAAATAAAGAAAAGGTATGTTCCTGG
CTCAGTTGAAAACATTATCAAGAATTTATAGTACTTTTAGTTGGAATGGGATGAAGGTAG
AGATTATTTAAATTATATATTATTTTTAAACAAACACATTGTACATCAACTAACAAAATA
AATATTAATAACTATAAAAAAGGTCCTGGAGCTCATGGAAAAAACAACTTAAACGATTAT
GAAAATTAAGGACCCTTCGGTCCTTACTTTTAATCTTAAAGACTATAATTATATTAAAAG
TATATTAAGGAATTAATTTAAAATGGAGATGCATACTACTGCTTTTGTGATTCAAATAGA
TTAGAAAAGCTTAAAAATGATTAGATTGAAAAGAAGTTGCCTTAAAAGTATGATGGACAC
TGTAGACATTTGACTGATGAACAGATTCGTATTAAACTGTTAAAAGGAGAAAAATACACA
ATTCGTTTAAAAGTAATGGTTTTTTATATGTTTTTCTACTATTATAAAATAAAAGTAGAC
TTTACAACATCAGTCATAATTATATCCTTTTATTCTTTAAGGTTCCTGAAGGAGAAACTA
CTTTCAATGATATAATACATGGAAAGATTACTATTAATAATTCTTAAGTAGATGATTAAA
TTTTAATTAAATCTGACGGATTTCCAACATATCACCTAGCTAATGTTATTGATGATTATT
AAATGAAAATATCTCATGTAATTAGAGGTCATGAATGGATAACTTCTACTCCTAAGCATC
TTATATTATACGATGCATTAAATATTAAACCTCCCAAATTTGCTCATATCCCTTTGCTAG
TTAAAGTAATTTATTTTTCAAAAATGGCATAATGAGTTATTAAAAATATCAAATACAGAA
AGGTGGGGCTAAACTATCTAAAAGAGATTAAAGTTCTAGCGTTGACTTCTTTAGAGAAAA
TGAGTATTTACCAGAAGCTGTGAACAATTTTGTTGCTCTTTTAGGCTGGTATCCTAAATT
TTTAGAAGATAGTTAAACTCTAAATGAGAAGTTTAGTCCTAAGGAAGAAGTGCTTGATAT
GAGTGAAATGGCTGCTTTAGTAAAATCTTAAAATAATTTAATAAAAATAATTGATTGATT
GATTTATTTCTTTAAAATAGTTTTCTCTTGAAAGAGTTAATCCATCAAACAGCTAGGTTG
ATGAAAAAAAATTAATTTTTTTGAATGGTTAACATTTACAAATAAAATTTAGAGATGTTA
GGATTGAAAAAGAGCTATAAAATGAATTTATGGATAAGATGGTTCAATATATTTAGATAG
ATAATTTAAAGTAAAAAATTTAAAGCTTCAATACTGAAGATTAGCTATTAATGATAGAAA
CTATTAGAGATAGAATATAATTATATTCCGAGATATCATAGTTTAAATACCTTTTTGAGC
AACCTGATTATAAAAATGATAATTCATAAAAATCTATTCAAAAAGTTGTTAAAAGTCTAA
AAAATGCTAATAAAGTAATCAAAGACTTTAAGGAAATTTTTGCAAGTCTTCACAATTAAA
ATAAATTTGAAATGACTTCATTGAGCAAGGCGATGAGCTAATATCTATTTGATAATAATC
CTCAAATAAAAAATGAAGATGTTTACCATTTTTTGAGATTAGCTATGTCTGGTTCTCACT
AAGGACCTTCTACTGCAACAATTTGTCATTTACTTGGGTATTAAAATGCATTAGAAAGAC
TTAATTATTTTGAAGAAAATGTTCTTTCTAACATAACAGAAGTAGAAGTTGAAAAATAAG
TTTGA