Identifiers and Description

Gene Model Identifier

TTHERM_00433590

Standard Name

ERI8 (ERI1-exoribonuclease 8)

Aliases

PreTt26501 | 48.m00264 | 3831.m01600

Description

exonuclease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00433590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08983.11.9999167998962255e-60hypothetical protein (427 aa)
OxytrichaContig3963.0.g421.9994498063102785e-22RNA 2-phosphotransferase, Tpt1
/ KptA family
WormBaseWBGene000013327.002638123733849e-21locus:eri-1 3-5 exonuclease
eri-1 status:Partially_confi
rmed UniProt:O44406 protei
n_id:CCD73975.1
DictyBaseDDB_G02831130.00000000030007160092483236eriA on chromosome: 4 position
263707 to 264369

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00433590(coding)
ATGGAGCAAAATAACAGTTTATCTCAATTCTTAAAAGTAGATCAAACAACTTTACCTAAA
ACTGTAATTGATAACAAATGTAATTAGAATATTTTCAATTTGATTCCTGAGCCCAGCAGT
TTATTTTAGGTGAATTAAATACAAAGTCAATAAAATCAGAATAGTTAGCCTATTCCTTCA
TTGGATTAATTTTATAACAAACAGCTACAATAAGCTATACAATTTTAGATTCAGAATTAT
CTAAAAAAGAGTTAATATAATTAGAAAATGGGAAAATTTAATCATAGCTAAAATTTTTAA
GCTTAACGGGGAAAAGGATTTCGCTTTTAAGATTAAGAGTAAACAAATGGAATCAATATA
TCTTAGAAAAATAATGAATTAAATATACTAAGCAAATAGTCATCTTAAAAGGAGCAGTTT
TAAAAAACTCGTGATAAAAAAAATCAGCTGACTCTTGATAAAAAGTTAAAGAAATTAGAA
GTATTATAAGAATAATAGATGATATTAAATTAATTCTAATAGCAATAAATGGAAAAGTTG
AAATTAATCTATTAACAACTTAATCATATTTAAGCTTAAAAGCTAAGCAAAAGTACTGAA
ATAAATTTTGAAATATAGTAAAATAGCACTACTATAAATACTGCTGCTCCTACCGATAGC
GATGACTAACAAAATTATCAGAATTCTACTAAGCAAGAGGGAGAATAGATTCAAAATAGC
AGCTCACTTCTTGATTAAACCAATGAAAAAAATCAAGACTAGATTAATGATTAACAAGAA
TAGAAGTCAGATGAAGAAGAAGCTAAAAATGAAAATAAAGATAAAGCAGCTGCTGAAGAA
ATAAGACAAAGTGATTTAGGGTAGAAATAAAGCGAATAAGAATAATCTTTTTAACAAGAT
GAATAAAATAATTTAGACAAATAAAGAAAATTTGTTTAAGCTAATTTAATGTAAAAAAAT
GCTAAAGAAAGTGATTATGATTACTTATTTTTTATTGATTATGAATGCAATTAATCTTAT
CTTGGATCTGAAATAATTGAGTTTCCTATTTAAGTTGTAGATGTGAAATAGTTAAAAATT
ATCGATACTTTTTCTTCATATGTGCAACCCTGTTCTAAAATTACTAAATTAATTACAAAT
CTGACTAAGATTGATGATAATAAAGTTTAAAATGCTCCTAAAATATAGTAAGTTCTTCAG
TAAGTTCGAATATTTTTGGAAAAATATTTGAAAAATAATTTTGATAGATGTGCTGTTGTT
TATGATAACAAATCAGATTTTTTGTTTATTGTTGAAGAATCTATCAAAAAGAATTTTTTA
CTTCCTGCTTTTCTATAACAATACATTGATCTTGGCACATGCTTTCCAATTAGAAACGAA
TAAAATATAAATGAGTAGAGAATTTCTCTTAAGGGTATGCTTGATACTTTAGGTATGAAA
TTTTAAGGCTAAAAGCATTGTGGTGCTGATGACTGTAAAAATCAAGCATTAGTAGCTATT
GAATTACTAAAGAGAGGATATAGCTTTACAAAAGATTTGTAAGTAAATGATCTAGAATAA
GTTATCACAAACTATTTCAAGAGAACTGAAAAGCAATTTGCTAAAAAACTATCAAAGTTA
AAAAATAAAATTTAGACGACCTATAAAAAGGAATGA


>TTHERM_00433590(protein)
MEQNNSLSQFLKVDQTTLPKTVIDNKCNQNIFNLIPEPSSLFQVNQIQSQQNQNSQPIPS
LDQFYNKQLQQAIQFQIQNYLKKSQYNQKMGKFNHSQNFQAQRGKGFRFQDQEQTNGINI
SQKNNELNILSKQSSQKEQFQKTRDKKNQLTLDKKLKKLEVLQEQQMILNQFQQQQMEKL
KLIYQQLNHIQAQKLSKSTEINFEIQQNSTTINTAAPTDSDDQQNYQNSTKQEGEQIQNS
SSLLDQTNEKNQDQINDQQEQKSDEEEAKNENKDKAAAEEIRQSDLGQKQSEQEQSFQQD
EQNNLDKQRKFVQANLMQKNAKESDYDYLFFIDYECNQSYLGSEIIEFPIQVVDVKQLKI
IDTFSSYVQPCSKITKLITNLTKIDDNKVQNAPKIQQVLQQVRIFLEKYLKNNFDRCAVV
YDNKSDFLFIVEESIKKNFLLPAFLQQYIDLGTCFPIRNEQNINEQRISLKGMLDTLGMK
FQGQKHCGADDCKNQALVAIELLKRGYSFTKDLQVNDLEQVITNYFKRTEKQFAKKLSKL
KNKIQTTYKKE


>TTHERM_00433590(gene)
ATGGAGCAAAATAACAGGTATGTATTTTAGTGATATTTATGGCTTATTTTAAAATATTTT
TTGTAAAATGCGATATAGTTTATCTCAATTCTTAAAAGTAGATCAAACAACTTTACCTAA
AACTGTAATTGATAACAAATGTAATTAGAATATTTTCAATTTGATTCCTGAGCCCAGCAG
TTTATTTTAGGTGAATTAAATACAAAGTCAATAAAATCAGAATAGTTAGCCTATTCCTTC
ATTGGATTAATTTTATAACAAACAGCTACAATAAGCTATACAATTTTAGATTCAGAATTA
TCTAAAAAAGAGTTAATATAATTAGAAAATGGGAAAATTTAATCATAGCTAAAATTTTTA
AGCTTAACGGGGAAAAGGATTTCGCTTTTAAGATTAAGAGTAAACAAATGGAATCAATAT
ATCTTAGAAAAATAATGAATTAAATATACTAAGCAAATAGTCATCTTAAAAGGAGCAGTT
TTAAAAAACTCGTGATAAAAAAAATCAGCTGACTCTTGATAAAAAGTTAAAGAAATTAGA
AGTATTATAAGAATAATAGATGATATTAAATTAATTCTAATAGCAATAAATGGAAAAGTT
GAAATTAATCTATTAACAACTTAATCATATTTAAGCTTAAAAGCTAAGCAAAAGTACTGA
AATAAATTTTGAAATATAGTAAAATAGCACTACTATAAATACTGCTGCTCCTACCGATAG
CGATGACTAACAAAATTATCAGAATTCTACTAAGCAAGAGGGAGAATAGATTCAAAATAG
CAGCTCACTTCTTGATTAAACCAATGAAAAAAATCAAGACTAGATTAATGATTAACAAGA
ATAGAAGTCAGATGAAGAAGAAGCTAAAAATGAAAATAAAGATAAAGCAGCTGCTGAAGA
AATAAGACAAAGTGATTTAGGGTAGAAATAAAGCGAATAAGAATAATCTTTTTAACAAGA
TGAATAAAATAATTTAGACAAATAAAGAAAATTTGTTTAAGCTAATTTAATGTAAAAAAA
TGCTAAAGAAAGTGATTATGATTACTTATTTTTTATTGATTATGAATGCAATTAATCTTA
TCTTGGATCTGAAATAATTGAGTTTCCTATTTAAGTTGTAGATGTGAAATAGTTAAAAAT
TATCGATACTTTTTCTTCATATGTGCAACCCTGTTCTAAAATTACTAAATTAATTACAAA
TCTGACTAAGATTGATGATAATAAAGTTTAAAATGCTCCTAAAATATAGTAAGTTCTTCA
GTAAGTTCGAATATTTTTGGAAAAATATTTGAAAAATAATTTTGATAGATGTGCTGTTGT
TTATGATAACAAATCAGATTTTTTGTTTATTGTTGAAGAATCTATCAAAAAGAATTTTTT
ACTTCCTGCTTTTCTATAACAATACATTGATCTTGGCACATGCTTTCCAATTAGAAACGA
ATAAAATATAAATGAGTAGAGAATTTCTCTTAAGGGTATGCTTGATACTTTAGGTATGAA
ATTTTAAGGCTAAAAGCATTGTGGTGCTGATGACTGTAAAAATCAAGCATTAGTAGCTAT
TGAATTACTAAAGAGAGGATATAGCTTTACAAAAGATTTGTAAGTAAATGATCTAGAATA
AGTTATCACAAACTATTTCAAGAGAACTGAAAAGCAATTTGCTAAAAAACTATCAAAGTT
AAAAAATAAAATTTAGACGACCTATAAAAAGGAATGA