Identifiers and Description

Gene Model Identifier

TTHERM_00689820

Standard Name

ERI7 (ExoRIbonuclease 7)

Aliases

PreTt23178 | 105.m00145 | 3737.m00057

Description

Exonuclease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.3%

TetraMine Data

TTHERM_00689820

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16632.12.0001701965494945e-132exonuclease (251 aa)
OxytrichaContig3963.0.g424.997860539111522e-53RNA 2-phosphotransferase, Tpt1
/ KptA family
DictyBaseDDB_G02831134.001118334825066e-42eriA on chromosome: 4 position
263707 to 264369
WormBaseWBGene000198256.997646692526315e-42status:Confirmed UniProt:Q9T
ZZ9 protein_id:CCD73172.1
Stentor CoeruleusSteCoe_237253.1391327920480296e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00689820(coding)
ATGGAAGAAGTAAAATAAAATTTGGAAGAAAAAATAAATCTAAATCATGACTTTGATTTT
CTCTTGATCTTAGATTTCGAAGCTACATGCAGTAATGATGAAAAACTAAATGTTTAAGAG
ATTATAGAATTCCCTATAGTTATTTTAGACCTTAAAAAAAATGTAATTTTACCTGAATAC
TTTCATACATATGTTAAACCTACTTATCATCCTATTCTGACAAAATTTTGCACTGAACTG
ACCCACATAACTTAAGAATAAGTGGATAATGGAGTCATTTTAGAATCTGCTATTTAGTAA
GCTGATGAATTTTTAAATAAAATGGGTATTATTGATAAAAAATTCGCTTTTGTTTGTTGT
GGTGATTTTGATCTTGGTTAATGTTTACGCTTAGAGGCTAAATTCAAGAAAATAAATTAT
CCATAATACTTTAAATAATATATCAACATAAAAAAATAATTTCCTAAAGAATGGTACACA
GAAAGTATTATTAAATGGAATAAACCTCCAGGTATGGTAGCAATGCTAAAAGCCATAAAT
CTTGAGCTTTAAGGAACACACCACTCTGGGTTAGACGACTCTAAAAATATAGCAAGAATA
GCATAGTTTATGGTAGAGCATAATATAGTATGGACTAAAGAAATGCTAAGCTAAGTTTAA
CGAGATAAAGTAAAAGAAAAAAAAACAAAAAAAGAGAAAAAGCTATTAAAATAAAATAAG
TAAAGAGATGACCTGGTGGAAACAAACAATAAATGA


>TTHERM_00689820(protein)
MEEVKQNLEEKINLNHDFDFLLILDFEATCSNDEKLNVQEIIEFPIVILDLKKNVILPEY
FHTYVKPTYHPILTKFCTELTHITQEQVDNGVILESAIQQADEFLNKMGIIDKKFAFVCC
GDFDLGQCLRLEAKFKKINYPQYFKQYINIKKQFPKEWYTESIIKWNKPPGMVAMLKAIN
LELQGTHHSGLDDSKNIARIAQFMVEHNIVWTKEMLSQVQRDKVKEKKTKKEKKLLKQNK
QRDDLVETNNK


>TTHERM_00689820(gene)
ATGGAAGAAGTAAAATAAAATTTGGAAGAAAAAATAAATCTAAATCATGACTTTGATTTT
CTCTTGATCTTAGATTTCGAAGCTACATGCAGTAATGATGAAAAACTAAATGTTTAAGAG
ATTATAGAATTCCCTATAGTTATTTTAGACCTTAAAAAAAATGTAATTTTACCTGAATAC
TTTCATACATATGTTAAACCTACTTATCATCCTATTCTGACAAAATTTTGCACTGAACTG
ACCCACATAACTTAAGAATAAGTGGATAATGGAGTCATTTTAGAATCTGCTATTTAGTAA
GCTGATGAATTTTTAAATAAAATGGGTATTATTGATAAAAAATTCGCTTTTGTTTGTTGT
GGTGATTTTGATCTTGGTTAATGTTTACGCTTAGAGGCTAAATTCAAGAAAATAAATTAT
CCATAATACTTTAAATAATATATCAACATAAAAAAATAATTTCCTAAAGAATGGTACACA
GAAAGTATTATTAAATGGAATAAACCTCCAGGTATGGTAGCAATGCTAAAAGCCATAAAT
CTTGAGCTTTAAGGAACACACCACTCTGGGTTAGACGACTCTAAAAATATAGCAAGAATA
GCATAGTTTATGGTAGAGCATAATATAGTATGGACTAAAGAAATGCTAAGCTAAGTTTAA
CGAGATAAAGTAAAAGAAAAAAAAACAAAAAAAGAGAAAAAGCTATTAAAATAAAATAAG
TAAAGAGATGACCTGGTGGAAACAAACAATAAATGA